| Product Number |
AVARP09015_P050 |
| Product Page |
www.avivasysbio.com/rgs5-antibody-middle-region-avarp09015-p050.html |
| Name |
RGS5 Antibody - middle region (AVARP09015_P050) |
| Protein Size (# AA) |
181 amino acids |
| Molecular Weight |
21kDa |
| NCBI Gene Id |
8490 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Regulator of G-protein signaling 5 |
| Alias Symbols |
MST092, MST106, MST129, MSTP032, MSTP092, MSTP106, MSTP129 |
| Peptide Sequence |
Synthetic peptide located within the following region: PDSVGDLVIPYNEKPEKPAKTQKTSLDEALQWRDSLDKLLQNNYGLASFKS |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Campbell,D.B., (er) Schizophr. Res. (2008) In press |
| Description of Target |
The regulator of G protein signaling (RGS) proteins are signal transduction molecules that have structural homology to SST2 of Saccharomyces cerevisiae and EGL-10 of Caenorhabditis elegans. Multiple genes homologous to SST2 are present in higher eukaryotes. RGS proteins are involved in the regulation of heterotrimeric G proteins by acting as GTPase activators.The regulator of G protein signaling (RGS) proteins are signal transduction molecules that have structural homology to SST2 of Saccharomyces cerevisiae and EGL-10 of Caenorhabditis elegans. Multiple genes homologous to SST2 are present in higher eukaryotes. RGS proteins are involved in the regulation of heterotrimeric G proteins by acting as GTPase activators.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-663 AU130764.1 1-663 664-2587 BX537427.1 499-2422 2588-3235 BU187973.1 34-681 3236-3746 AL600981.1 90-600 3747-4143 AA486366.1 76-472 4144-4358 AA974387.1 113-327 c 4359-4664 BX537427.1 4194-4499 4665-5573 AF176919.1 724-1632 5574-5848 BX537427.1 5409-5683 |
| Protein Interactions |
ADRB2; APP; GNAQ; GNAI3; GNAI2; GNAO1; GNAI1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-RGS5 (AVARP09015_P050) antibody |
| Blocking Peptide |
For anti-RGS5 (AVARP09015_P050) antibody is Catalog # AAP30214 (Previous Catalog # AAPP00371) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human RGS5 |
| Uniprot ID |
O15539 |
| Protein Name |
Regulator of G-protein signaling 5 |
| Protein Accession # |
NP_003608 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_003617 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
RGS5 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Pig |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 92%; Human: 100%; Mouse: 84%; Pig: 76%; Rat: 84% |
| Image 1 | Human Heart
 | WB Suggested Anti-RGS5 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human heart |
|
| Image 2 | Hum. Fetal Heart
 | Hum. Fetal Heart |
|
