RGS10 Antibody - middle region (AVARP09013_T100)

• Product Number: AVARP09013_T100
• Name: RGS10 Antibody - middle region (AVARP09013_T100)
• Protein Size (# AA): 181 amino acids
• Molecular Weight: 21kDa
• NCBI Gene Id: 6001
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Regulator of G-protein signaling 10
• Peptide Sequence: Synthetic peptide located within the following region: DQIFNLMKYDSYSRFLKSDLFLKHKRTEEEEEDLPDAQTAAKRASRIYNT
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Oh,J.H., et al., (2005) Mamm. Genome 16 (12), 942-954
• Description of Target: Regulator of G protein signaling (RGS) family members are regulatory molecules that act as GTPase activating proteins (GAPs) for G alpha subunits of heterotrimeric G proteins. RGS proteins are able to deactivate G protein subunits of the Gi alpha, Go alpha and Gq alpha subtypes. They drive G proteins into their inactive GDP-bound forms. Regulator of G protein signaling 10 belongs to this family. All RGS proteins share a conserved 120-amino acid sequence termed the RGS domain. This protein associates specifically with the activated forms of the two related G-protein subunits, G-alphai3 and G-alphaz but fails to interact with the structurally and functionally distinct G-alpha subunits. Regulator of G protein signaling 10 protein is localized in the nucleus. Two transcript variants encoding different isoforms have been found for this gene.
• Protein Interactions: UBC; ADRB2; APP; PRKACA; GNAI3; GNAO1; GNAI1; GNAZ; GNRHR; CALM1; ACP6; SAP18; EIF6;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-RGS10 (AVARP09013_T100) antibody is Catalog # AAP30209
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RGS10
• Uniprot ID: Q96GN0
• Protein Name: Regulator of G-protein signaling 10
• Sample Type Confirmation:

  There is BioGPS gene expression data showing that RGS10 is expressed in Jurkat

• Protein Accession #: NP_001005339
• Purification: Protein A purified
• Nucleotide Accession #: NM_001005339
• Tested Species Reactivity: Human
• Gene Symbol: RGS10
• Predicted Species Reactivity: Human, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 81%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Rabbit: 90%; Rat: 90%
• Image 1: Human Jurkat
  
  WB Suggested Anti-RGS10 Antibody
  Titration: 1.25 ug/ml
  Positive Control: Jurkat Whole CellThere is BioGPS gene expression data showing that RGS10 is expressed in Jurkat