DNAJB5 Antibody - N-terminal region (AVARP09012_T100)

Data Sheet
 
Product Number AVARP09012_T100
Product Page www.avivasysbio.com/dnajb5-antibody-n-terminal-region-avarp09012-t100.html
Name DNAJB5 Antibody - N-terminal region (AVARP09012_T100)
Protein Size (# AA) 348 amino acids
Molecular Weight 39kDa
NCBI Gene Id 25822
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name DnaJ (Hsp40) homolog, subfamily B, member 5
Alias Symbols Hsc40
Peptide Sequence Synthetic peptide located within the following region: MGKDYYKILGIPSGANEDEIKKAYRKMALKYHPDKNKEPNAEEKFKEIAE
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Chen, M.S., et al., (1999) Gene 238:333-341.
Description of Target HSP40 is a new member of the hsp40 family, exhibits similar expression profile to that of hsc70 in mammalian cells.
Protein Interactions ASB4; UBC; SKP2; EBNA-LP; CACNA1A; TBPL2; HDAC4;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-DNAJB5 (AVARP09012_T100) antibody
Blocking Peptide For anti-DNAJB5 (AVARP09012_T100) antibody is Catalog # AAP30178 (Previous Catalog # AAPP00335)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human DNAJB5
Uniprot ID O75953
Protein Name DnaJ homolog subfamily B member 5
Protein Accession # NP_036398
Purification Protein A purified
Nucleotide Accession # NM_012266
Gene Symbol DNAJB5
Predicted Species Reactivity Human, Mouse, Rat, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Image 1

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com