| Product Number |
AVARP09008_P050 |
| Product Page |
www.avivasysbio.com/traf1-antibody-middle-region-avarp09008-p050.html |
| Name |
TRAF1 Antibody - middle region (AVARP09008_P050) |
| Protein Size (# AA) |
416 amino acids |
| Molecular Weight |
46kDa |
| NCBI Gene Id |
7185 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
TNF receptor-associated factor 1 |
| Alias Symbols |
EBI6, MGC:10353 |
| Peptide Sequence |
Synthetic peptide located within the following region: DAFRPDLSSASFQRPQSETNVASGCPLFFPLSKLQSPKHAYVKDDTMFLK |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
(2008) Genes Immun. 9 (4), 379-382 |
| Description of Target |
This protein is a member of the TNF receptor (TNFR) associated factor (TRAF) protein family. TRAF proteins associate with, and mediate the signal transduction from various receptors of the TNFR superfamily. This protein and TRAF2 form a heterodimeric complex, which is required for TNF-alpha-mediated activation of MAPK8/JNK and NF-kappaB. The protein complex formed by this protein and TRAF2 also interacts with inhibitor-of-apoptosis proteins (IAPs), and thus mediates the anti-apoptotic signals from TNF receptors. The expression of this protein can be induced by Epstein-Barr virus (EBV). EBV infection membrane protein 1 (LMP1) is found to interact with this and other TRAF proteins; this interaction is thought to link LMP1-mediated B lymphocyte transformation to the signal transduction from TNFR family receptors.The protein encoded by this gene is a member of the TNF receptor (TNFR) associated factor (TRAF) protein family. TRAF proteins associate with, and mediate the signal transduction from various receptors of the TNFR superfamily. This protein and TRAF2 form a heterodimeric complex, which is required for TNF-alpha-mediated activation of MAPK8/JNK and NF-kappaB. The protein complex formed by this protein and TRAF2 also interacts with inhibitor-of-apoptosis proteins (IAPs), and thus mediates the anti-apoptotic signals from TNF receptors. The expression of this protein can be induced by Epstein-Barr virus (EBV). EBV infection membrane protein 1 (LMP1) is found to interact with this and other TRAF proteins; this interaction is thought to link LMP1-mediated B lymphocyte transformation to the signal transduction from TNFR family receptors. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
| Protein Interactions |
ZNF662; KLHL38; TRIM42; RTP5; SSC5D; MORN3; POM121L4P; OLIG3; CCDC116; ZNF564; SLC25A48; ALS2CR11; LOC149950; ZNF417; TMC8; ZNF572; RBM45; C1orf216; ZNF440; TBC1D16; HAUS1; SYCE1; ZNF502; C5orf30; CCDC120; FBF1; ZNF587; BEX2; LCOR; FAM161A; PLEKHN1; RASSF |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-TRAF1 (AVARP09008_P050) antibody |
| Blocking Peptide |
For anti-TRAF1 (AVARP09008_P050) antibody is Catalog # AAP30221 (Previous Catalog # AAPP00378) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human TRAF1 |
| Uniprot ID |
Q13077 |
| Protein Name |
TNF receptor-associated factor 1 |
| Protein Accession # |
NP_005649 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_005658 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
TRAF1 |
| Predicted Species Reactivity |
Human, Mouse, Cow, Dog, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Zebrafish: 84% |
| Image 1 | Human 293T
 | WB Suggested Anti-TRAF1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 293T cell lysate |
|
