RGS11 Antibody - middle region (AVARP09004_P050)

• Product Number: AVARP09004_P050
• Name: RGS11 Antibody - middle region (AVARP09004_P050)
• Protein Size (# AA): 446 amino acids
• Molecular Weight: 51kDa
• NCBI Gene Id: 8786
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Regulator of G-protein signaling 11
• Alias Symbols: RS11
• Peptide Sequence: Synthetic peptide located within the following region: LRQPHRYVLDDAQLHIYMLMKKDSYPRFLKSDMYKALLAEAGIPLEMKRR
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Martin,J., (2004) Nature 432 (7020), 988-994
• Description of Target: RGS11 belongs to the RGS (regulator of G protein signaling) family. Members of the RGS family act as GTPase-activating proteins on the alpha subunits of heterotrimeric, signal-transducing G proteins. This protein inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits, thereby driving them into their inactive GDP-bound form.The protein encoded by this gene belongs to the RGS (regulator of G protein signaling) family. Members of the RGS family act as GTPase-activating proteins on the alpha subunits of heterotrimeric, signal-transducing G proteins. This protein inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits, thereby driving them into their inactive GDP-bound form. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified.
• Protein Interactions: GNB5; ADRB2; SNTA1; HSP90AA1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-RGS11 (AVARP09004_P050) antibody is Catalog # AAP30210 (Previous Catalog # AAPP00367)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RGS11
• Uniprot ID: Q4TT72
• Protein Name: Regulator of G-protein signalling 11 EMBL CAI95581.1
• Protein Accession #: NP_003825
• Purification: Affinity Purified
• Nucleotide Accession #: NM_003834
• Tested Species Reactivity: Human
• Gene Symbol: RGS11
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 83%
• Image 1: Human 293T
  
  WB Suggested Anti-RGS11 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:12500
  Positive Control: 293T cell lysate