DOK1 Antibody - C-terminal region (AVARP09001_P050)

Data Sheet
 
Product Number AVARP09001_P050
Product Page www.avivasysbio.com/dok1-antibody-c-terminal-region-avarp09001-p050.html
Name DOK1 Antibody - C-terminal region (AVARP09001_P050)
Protein Size (# AA) 481 amino acids
Molecular Weight 53kDa
NCBI Gene Id 1796
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Docking protein 1, 62kDa (downstream of tyrosine kinase 1)
Alias Symbols pp62, P62DOK
Peptide Sequence Synthetic peptide located within the following region: EPGTATGSGIKSHNSALYSQVQKSGASGSWDCGLSRVGTDKTGVKSEGST
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Zhao,M., (2006) Mol. Cell. Biol. 26 (7), 2479-2489.
Sanjuan,J., et al., (2006) Psychiatr. Genet. 16 (2), 67-72.
Description of Target DOK1 is constitutively tyrosine phosphorylated in hematopoietic progenitors isolated from chronic myelogenous leukemia (CML) patients in the chronic phase. It may be a critical substrate for p210(bcr/abl), a chimeric protein whose presence is associated with CML. DOK1 contains a putative pleckstrin homology domain at the amino terminus and ten PXXP SH3 recognition motifs. Docking protein 2 binds p120 (RasGAP) from CML cells. It has been postulated to play a role in mitogenic signaling.Docking protein 1 is constitutively tyrosine phosphorylated in hematopoietic progenitors isolated from chronic myelogenous leukemia (CML) patients in the chronic phase. It may be a critical substrate for p210(bcr/abl), a chimeric protein whose presence is associated with CML. Docking protein 1 contains a putative pleckstrin homology domain at the amino terminus and ten PXXP SH3 recognition motifs. Docking protein 2 binds p120 (RasGAP) from CML cells. It has been postulated to play a role in mitogenic signaling.
Protein Interactions UBC; RASA1; ABL1; CD28; Nck1; Syngap1; INSR; CRKL; BCR; Dlg4; gag-pol; ERBB2; VAV1; SRC; SHC1; PTK6; PIK3R1; ITK; FGR; CRK; ABL2; CBLL1; INPP5D; NCK2; MAP4K4; PTPRH; GRB10; TEC; ITGB2; SH2D1A; FES; PTPN6; ITGB3; PLCG1; LYN; KIT; YES1; RET; LCK; ITGB5; ITG
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-DOK1 (AVARP09001_P050) antibody
Blocking Peptide For anti-DOK1 (AVARP09001_P050) antibody is Catalog # AAP30173
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human DOK1
Uniprot ID Q99704
Protein Name Docking protein 1
Protein Accession # NP_001372
Purification Affinity Purified
Nucleotide Accession # NM_001381
Tested Species Reactivity Human
Gene Symbol DOK1
Predicted Species Reactivity Human, Horse
Application WB
Predicted Homology Based on Immunogen Sequence Horse: 84%; Human: 100%
Image 1
Human 293T
WB Suggested Anti-DOK1 Antibody Titration: 0.2-1 ug/ml
Positive Control: Transfected 293T
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com