INSR Antibody - middle region (AVARP08005_P050)

Data Sheet
 
Product Number AVARP08005_P050
Product Page https://www.avivasysbio.com/insr-antibody-middle-region-avarp08005-p050.html
Name INSR Antibody - middle region (AVARP08005_P050)
Protein Size (# AA) 1382 amino acids
Molecular Weight 154kDa
NCBI Gene Id 3643
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Insulin receptor
Alias Symbols HHF5, CD220
Peptide Sequence Synthetic peptide located within the following region: SSHCQREEAGGRDGGSSLGFKRSYEEHIPYTHMNGGKKNGRILTLPRSNP
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Netzer,C., (2008) Genomics 91 (6), 503-507
Description of Target This receptor binds insulin and has a tyrosine-protein kinase activity. Isoform Short has a higher affinity for insulin. INSR mediates the metabolic functions of insulin. INSR binding to insulin stimulates association of the receptor with downstream mediators including IRS1 and phosphatidylinositol 3'-kinase (PI3K). INSR can activate PI3K either directly by binding to the p85 regulatory subunit, or indirectly via IRS1. When present in a hybrid receptor with IGF1R, it binds IGF1.A report shows that hybrid receptors composed of IGF1R and INSR isoform Long are activated with a high affinity by IGF1, with low affinity by IGF2 and not significantly activated by insulin, and that hybrid receptors composed of IGF1R and INSR isoform Short are activated by IGF1, IGF2 and insulin. In contrast, another report shows that hybrid receptors composed of IGF1R and INSR isoform Long and hybrid receptors composed of IGF1R and INSR isoform Short have similar binding characteristics, both bind IGF1 and have a low affinity for insulin.After removal of the precursor signal peptide, the insulin receptor precursor is post-translationally cleaved into two chains (alpha and beta) that are covalently linked. Binding of insulin to the insulin receptor (INSR) stimulates glucose uptake. Two transcript variants encoding different isoforms have been found for this gene.
Protein Interactions KRT31; UBC; ARRB2; MOK; Grb2; Hgf; DOK1; SH2B1; Stat5b; TEAD1; STAT5A; JAK2; JAK1; IRS1; IRF7; PLCG1; GRB10; Socs6; Socs1; SOCS3; SH2B2; HGS; INPPL1; Calmodulin; Mad2l1; KRT27; DOK5; DOK4; SNX6; SNX4; SNX2; ACP1; PTPN2; SYNCRIP; FRS2; PIK3R3; VAV3; ARHGAP
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-INSR (AVARP08005_P050) antibody
Additional Information IHC Information: Placenta
Blocking Peptide For anti-INSR (AVARP08005_P050) antibody is Catalog # AAP30446 (Previous Catalog # AAPP01030)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human INSR
Uniprot ID P06213
Protein Name Insulin receptor
Protein Accession # NP_000199
Purification Affinity Purified
Nucleotide Accession # NM_000208
Tested Species Reactivity Human
Gene Symbol INSR
Predicted Species Reactivity Human, Mouse, Rat, Dog, Guinea Pig, Horse, Zebrafish
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Rat: 93%; Zebrafish: 86%
Image 1
Human THP-1
WB Suggested Anti-INSR Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: THP-1 cell lysate
Image 2
Human Placenta
Placenta