Product Number |
AVARP07049_P050 |
Product Page |
www.avivasysbio.com/ccl18-antibody-middle-region-avarp07049-p050.html |
Name |
CCL18 Antibody - middle region (AVARP07049_P050) |
Protein Size (# AA) |
89 amino acids |
Molecular Weight |
10kDa |
NCBI Gene Id |
6362 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Chemokine (C-C motif) ligand 18 (pulmonary and activation-regulated) |
Alias Symbols |
CKb7, PARC, AMAC1, DCCK1, MIP-4, AMAC-1, DC-CK1, SCYA18 |
Peptide Sequence |
Synthetic peptide located within the following region: PQKFIVDYSETSPQCPKPGVILLTKRGRQICADPNKKWVQKYISDLKLNA |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Schraufstatter,I., et al., (2004) Am. J. Physiol. Lung Cell Mol. Physiol. 286 (3), L494-L501 |
Description of Target |
CCL18 is one of several Cys-Cys (CC) cytokine genes clustered on the q arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by CCL18 displays chemotactic activity for naive T cells, CD4+ and CD8+ T cells and nonactivated lymphocytes, but not for monocytes or granulocytes. This chemokine attracts naive T lymphocytes toward dendritic cells and activated macrophages in lymph nodes. It may play a role in both humoral and cell-mediated immunity responses. |
Protein Interactions |
C14orf1; UNC119; CRMP1; TLE1; TP53; EEF1A1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-CCL18 (AVARP07049_P050) antibody |
Blocking Peptide |
For anti-CCL18 (AVARP07049_P050) antibody is Catalog # AAP30861 (Previous Catalog # AAPP01530) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human CCL18 |
Uniprot ID |
P55774 |
Protein Name |
C-C motif chemokine 18 |
Protein Accession # |
NP_002979 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_002988 |
Tested Species Reactivity |
Human |
Gene Symbol |
CCL18 |
Predicted Species Reactivity |
Human |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Human: 100% |
Image 1 | Human HT1080 Whole Cell
| Host: Rabbit Target Name: CCL18 Sample Tissue: Human HT1080 Whole Cell Antibody Dilution: 1ug/ml |
|
Image 2 | Human lung, HepG2
| Host: Rabbit Target: CCL18 Positive control (+): Human lung (LU) Negative control (-): HepG2 (HG) Antibody concentration: 1ug/ml |
|
Image 3 | Human Intestine
| Human Intestine |
|
Image 4 | Human Fetal Lung
| Host: Rabbit Target Name: CCL18 Sample Type: Fetal Lung lysates Antibody Dilution: 0.5ug/ml |
|