| Product Number |
AVARP07040_P050 |
| Product Page |
www.avivasysbio.com/gpr18-antibody-middle-region-avarp07040-p050.html |
| Name |
GPR18 Antibody - middle region (AVARP07040_P050) |
| Protein Size (# AA) |
331 amino acids |
| Molecular Weight |
38kDa |
| NCBI Gene Id |
2841 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
G protein-coupled receptor 18 |
| Alias Symbols |
- |
| Peptide Sequence |
Synthetic peptide located within the following region: GVWIMTLTTTTPLLLLYKDPDKDSTPATCLKISDIIYLKAVNVLNLTRLT |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Kohno,M., (2006) Biochem. Biophys. Res. Commun. 347 (3), 827-832 |
| Description of Target |
GPR18 is receptor for N-arachidonyl glycine. The activity of this receptor is mediated by G proteins which inhibit adenylyl cyclase. It may contribute to regulation of the immune system. N-arachidonylglycine is a natural ligand for GPR18. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-GPR18 (AVARP07040_P050) antibody |
| Blocking Peptide |
For anti-GPR18 (AVARP07040_P050) antibody is Catalog # AAP30829 (Previous Catalog # AAPP01493) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human GPR18 |
| Uniprot ID |
Q14330 |
| Protein Name |
N-arachidonyl glycine receptor |
| Protein Accession # |
NP_005283 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_005292 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
GPR18 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100% |
| Image 1 | Human Muscle
 | WB Suggested Anti-GPR18 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Muscle |
|
|
