| Product Number |
AVARP07026_P050 |
| Product Page |
www.avivasysbio.com/ccl8-antibody-middle-region-avarp07026-p050.html |
| Name |
CCL8 Antibody - middle region (AVARP07026_P050) |
| Protein Size (# AA) |
99 amino acids |
| Molecular Weight |
11 kDa |
| NCBI Gene Id |
6355 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Chemokine (C-C motif) ligand 8 |
| Alias Symbols |
HC14, MCP2, MCP-2, SCYA8, SCYA10 |
| Peptide Sequence |
Synthetic peptide located within the following region: SYTRITNIQCPKEAVIFKTKRGKEVCADPKERWVRDSMKHLDQIFQNLKP |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Hori,T., (2008) Blood 111 (8), 4403-4412 |
| Description of Target |
CCL8 gene is one of several cytokine genes clustered on the q-arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The protein is structurally related to the CXC subfamily of cytokines. Members of this subfamily are characterized by two cysteines separated by a single amino acid. This cytokine displays chemotactic activity for monocytes, lymphocytes, basophils and eosinophils. By recruiting leukocytes to sites of inflammation this cytokine may contribute to tumor-associated leukocyte infiltration and to the antiviral state against HIV infection.This gene is one of several cytokine genes clustered on the q-arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The protein encoded by this gene is structurally related to the CXC subfamily of cytokines. Members of this subfamily are characterized by two cysteines separated by a single amino acid. This cytokine displays chemotactic activity for monocytes, lymphocytes, basophils and eosinophils. By recruiting leukocytes to sites of inflammation this cytokine may contribute to tumor-associated leukocyte infiltration and to the antiviral state against HIV infection. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
| Protein Interactions |
ACKR2; ACKR4; CCR5; CCR3; CCR2; CCR1; MMP3; VCAN; ACKR1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-CCL8 (AVARP07026_P050) antibody |
| Blocking Peptide |
For anti-CCL8 (AVARP07026_P050) antibody is Catalog # AAP30808 (Previous Catalog # AAPP01471) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human CCL8 |
| Uniprot ID |
P80075 |
| Protein Name |
C-C motif chemokine 8 |
| Protein Accession # |
NP_005614 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_005623 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
CCL8 |
| Predicted Species Reactivity |
Human |
| Application |
WB, IHC |
| Predicted Homology Based on Immunogen Sequence |
Human: 100% |
| Image 1 | Human Heart
 | WB Suggested Anti-CCL8 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human heart |
|
| Image 2 | Human Adrenal
 | Rabbit Anti-CCL8 antibody
Catalog Number: AVARP07026
Formalin Fixed Paraffin Embedded Tissue: Human Adrenal
Primary antibody Concentration: 1:100
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20x
Exposure Time: 0.5-2.0sec |
|
| Image 3 |
 | 25 ug of the indicated Human whole cell extracts was loaded onto a 10-20% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment.
|
|
