CXCL14 Antibody - middle region : HRP (AVARP07023_T100-HRP)

Data Sheet
 
Product Number AVARP07023_T100-HRP
Product Page www.avivasysbio.com/cxcl14-antibody-middle-region-hrp-avarp07023-t100-hrp.html
Name CXCL14 Antibody - middle region : HRP (AVARP07023_T100-HRP)
Protein Size (# AA) 111 amino acids
Molecular Weight 13kDa
Conjugation HRP: Horseradish Peroxidase
NCBI Gene Id 9547
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Chemokine (C-X-C motif) ligand 14
Alias Symbols KEC, KS1, BMAC, BRAK, NJAC, MIP2G, MIP-2g, SCYB14
Peptide Sequence Synthetic peptide located within the following region: HCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE
Product Format Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Reference Clark,H.F., et al., (2003) Genome Res. 13 (10), 2265-2270
Description of Target CXCL14 belongs to the cytokine family which encode secreted proteins involved in immunoregulatory and inflammatory processes. The protein encoded by this gene is structurally related to the CXC (Cys-X-Cys) subfamily of cytokines. Members of this subfamily are characterized by two cysteines separated by a single amino acid. This cytokine displays chemotactic activity for monocytes but not for lymphocytes, dendritic cells, neutrophils or macrophages. It has been implicated that this cytokine is involved in the homeostasis of monocyte-derived macrophages rather than in inflammation.
Protein Interactions TEX11; TRIM23; REL; APP;
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Datasheets/Manuals Printable datasheet for anti-CXCL14 (AVARP07023_T100-HRP) antibody
Blocking Peptide For anti-CXCL14 (AVARP07023_T100-HRP) antibody is Catalog # AAP30802 (Previous Catalog # AAPP01465)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human CXCL14
Uniprot ID Q9NS21
Protein Name C-X-C motif chemokine 14
Protein Accession # NP_004878
Nucleotide Accession # NM_004887
Gene Symbol CXCL14
Predicted Species Reactivity Rat, Cow, Dog, Guinea Pig, Horse
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Rat: 100%
Image 1

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com