CXCL14 Antibody - middle region : FITC (AVARP07023_P050-FITC)

• Product Number: AVARP07023_P050-FITC
• Name: CXCL14 Antibody - middle region : FITC (AVARP07023_P050-FITC)
• Protein Size (# AA): 111 amino acids
• Molecular Weight: 9kDa
• Conjugation: FITC: Fluorescein Isothiocyanate
• NCBI Gene Id: 9547
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Chemokine (C-X-C motif) ligand 14
• Alias Symbols: KEC, KS1, BMAC, BRAK, NJAC, MIP2G, MIP-2g, SCYB14
• Peptide Sequence: Synthetic peptide located within the following region: PHCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYE
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Description of Target: CXCL14 belongs to the cytokine family which encode secreted proteins involved in immunoregulatory and inflammatory processes. The protein encoded by this gene is structurally related to the CXC (Cys-X-Cys) subfamily of cytokines. Members of this subfamily are characterized by two cysteines separated by a single amino acid. This cytokine displays chemotactic activity for monocytes but not for lymphocytes, dendritic cells, neutrophils or macrophages. It has been implicated that this cytokine is involved in the homeostasis of monocyte-derived macrophages rather than in inflammation.
• Protein Interactions: TEX11; TRIM23; REL; APP;
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Blocking Peptide: For anti-CXCL14 (AVARP07023_P050-FITC) antibody is Catalog # AAP30802
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CXCL14
• Uniprot ID: O95715
• Protein Name: C-X-C motif chemokine 14
• Publications:

  Takahashi, M. et al. CXCL14 enhances insulin-dependent glucose uptake in adipocytes and is related to high-fat diet-induced obesity. Biochem. Biophys. Res. Commun. 364, 1037-42 (2007). WB, Bovine, Dog, Guinea pig, Horse, Pig, Rat 17971304

  Lietz, R. et al. Codelivery of the chemokine CCL3 by an adenovirus-based vaccine improves protection from retrovirus infection. J. Virol. 86, 1706-16 (2012). WB, Bovine, Dog, Guinea pig, Horse, Pig, Rat 22090142

  Perrone, C. E. et al. Genomic and metabolic responses to methionine-restricted and methionine-restricted, cysteine-supplemented diets in Fischer 344 rat inguinal adipose tissue, liver and quadriceps muscle. J. Nutrigenet. Nutrigenomics 5, 132-57 (2012). WB, Bovine, Dog, Guinea pig, Horse, Pig, Rat 23052097

• Protein Accession #: NP_004878
• Nucleotide Accession #: NM_004887
• Gene Symbol: CXCL14
• Predicted Species Reactivity: Rat, Cow, Dog, Guinea Pig, Horse
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Rat: 100%
• Image 1: