| Product Number |
AVARP07017_P050 |
| Product Page |
www.avivasysbio.com/ccr4-antibody-middle-region-avarp07017-p050.html |
| Name |
CCR4 Antibody - middle region (AVARP07017_P050) |
| Protein Size (# AA) |
360 amino acids |
| Molecular Weight |
41kDa |
| NCBI Gene Id |
1233 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Chemokine (C-C motif) receptor 4 |
| Alias Symbols |
CKR4, K5-5, CD194, CMKBR4, ChemR13, CC-CKR-4, HGCN:14099 |
| Peptide Sequence |
Synthetic peptide located within the following region: TERNHTYCKTKYSLNSTTWKVLSSLEINILGLVIPLGIMLFCYSMIIRTL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Nakayama,T., (2008) Oncogene 27 (23), 3221-3232 |
| Description of Target |
CCR4 belongs to the G-protein-coupled receptor family . It is a receptor for the CC chemokine - MIP-1, RANTES, TARC and MCP-1. Chemokines are a group of small polypeptide, structurally related molecules that regulate cell trafficking of various types of leukocytes. The chemokines also play fundamental roles in the development, homeostasis, and function of the immune system, and they have effects on cells of the central nervous system as well as on endothelial cells involved in angiogenesis or angiostasis. The protein encoded by this gene belongs to the G-protein-coupled receptor family . It is a receptor for the CC chemokine - MIP-1, RANTES, TARC and MCP-1. Chemokines are a group of small polypeptide, structurally related molecules that regulate cell trafficking of various types of leukocytes. The chemokines also play fundamental roles in the development, homeostasis, and function of the immune system, and they have effects on cells of the central nervous system as well as on endothelial cells involved in angiogenesis or angiostasis. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1657 BC071751.1 1-1657 |
| Protein Interactions |
CCL22; CCL17; CCL5; CCL3; ADRBK2; ADRBK1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-CCR4 (AVARP07017_P050) antibody |
| Blocking Peptide |
For anti-CCR4 (AVARP07017_P050) antibody is Catalog # AAP30786 (Previous Catalog # AAPP01449) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human CCR4 |
| Uniprot ID |
P51679 |
| Protein Name |
C-C chemokine receptor type 4 |
| Sample Type Confirmation |
CCR4 is supported by BioGPS gene expression data to be expressed in 721_B |
| Protein Accession # |
NP_005499 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_005508 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
CCR4 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 87%; Dog: 87%; Human: 100%; Mouse: 87%; Rat: 87% |
| Image 1 | Human 721_B
 | WB Suggested Anti-CCR4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 721_B cell lysateCCR4 is supported by BioGPS gene expression data to be expressed in 721_B |
|
