Product Number |
AVARP06008_T100 |
Product Page |
www.avivasysbio.com/akt1-antibody-n-terminal-region-avarp06008-t100.html |
Name |
AKT1 Antibody - N-terminal region (AVARP06008_T100) |
Protein Size (# AA) |
480 amino acids |
Molecular Weight |
56kDa |
NCBI Gene Id |
207 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
V-akt murine thymoma viral oncogene homolog 1 |
Alias Symbols |
AKT, PKB, RAC, PRKBA, PKB-ALPHA, RAC-ALPHA |
Peptide Sequence |
Synthetic peptide located within the following region: RSGSPSDNSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEK |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Jones, P.F., et al., (1991) Proc. Natl. Acad. Sci. U.S.A. 88: 4171-4175. |
Description of Target |
AKT1 is a general protein kinase capable of phosphorylating several known proteins. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-AKT1 (AVARP06008_T100) antibody |
Blocking Peptide |
For anti-AKT1 (AVARP06008_T100) antibody is Catalog # AAP30466 (Previous Catalog # AAPP01102) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human AKT1 |
Uniprot ID |
P31749 |
Protein Name |
RAC-alpha serine/threonine-protein kinase |
Protein Accession # |
NP_005154 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_005163 |
Tested Species Reactivity |
Human |
Gene Symbol |
AKT1 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Goat, Pig, Sheep |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 100%; Goat: 86%; Human: 100%; Mouse: 100%; Pig: 93%; Rat: 100%; Sheep: 86% |
Image 1 | Human Small Intestine
| WB Suggested Anti-AKT1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Small Intestine |
|
|