AKT1 Antibody - N-terminal region (AVARP06008_T100)

Data Sheet
 
Product Number AVARP06008_T100
Product Page www.avivasysbio.com/akt1-antibody-n-terminal-region-avarp06008-t100.html
Name AKT1 Antibody - N-terminal region (AVARP06008_T100)
Protein Size (# AA) 480 amino acids
Molecular Weight 56kDa
NCBI Gene Id 207
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name V-akt murine thymoma viral oncogene homolog 1
Alias Symbols AKT, PKB, RAC, PRKBA, PKB-ALPHA, RAC-ALPHA
Peptide Sequence Synthetic peptide located within the following region: RSGSPSDNSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEK
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Jones, P.F., et al., (1991) Proc. Natl. Acad. Sci. U.S.A. 88: 4171-4175.
Description of Target AKT1 is a general protein kinase capable of phosphorylating several known proteins.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-AKT1 (AVARP06008_T100) antibody
Blocking Peptide For anti-AKT1 (AVARP06008_T100) antibody is Catalog # AAP30466 (Previous Catalog # AAPP01102)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human AKT1
Uniprot ID P31749
Protein Name RAC-alpha serine/threonine-protein kinase
Protein Accession # NP_005154
Purification Protein A purified
Nucleotide Accession # NM_005163
Tested Species Reactivity Human
Gene Symbol AKT1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Goat, Pig, Sheep
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 100%; Goat: 86%; Human: 100%; Mouse: 100%; Pig: 93%; Rat: 100%; Sheep: 86%
Image 1
Human Small Intestine
WB Suggested Anti-AKT1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Small Intestine
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com