AKT1 Antibody - N-terminal region (AVARP06008_P050)

• Product Number: AVARP06008_P050
• Name: AKT1 Antibody - N-terminal region (AVARP06008_P050)
• Protein Size (# AA): 480 amino acids
• Molecular Weight: 56kDa
• NCBI Gene Id: 207
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: V-akt murine thymoma viral oncogene homolog 1
• Description:
  View product citations for AKT1 Antibody - N-terminal region (AVARP06008_P050) on CiteAb
• Alias Symbols: AKT, PKB, RAC, PRKBA, PKB-ALPHA, RAC-ALPHA
• Peptide Sequence: Synthetic peptide located within the following region: RSGSPSDNSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEK
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Kim,H.A., et al., (2006) Exp. Mol. Pathol. 80 (2), 165-170
• Description of Target: AKT1 is a general protein kinase capable of phosphorylating several known proteins.The serine-threonine protein kinase encoded by the AKT1 gene is catalytically inactive in serum-starved primary and immortalized fibroblasts. AKT1 and the related AKT2 are activated by platelet-derived growth factor. The activation is rapid and specific, and it is abrogated by mutations in the pleckstrin homology domain of AKT1. It was shown that the activation occurs through phosphatidylinositol 3-kinase. In the developing nervous system AKT is a critical mediator of growth factor-induced neuronal survival. Survival factors can suppress apoptosis in a transcription-independent manner by activating the serine/threonine kinase AKT1, which then phosphorylates and inactivates components of the apoptotic machinery. Multiple alternatively spliced transcript variants have been found for this gene.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-AKT1 (AVARP06008_P050) antibody is Catalog # AAP30466
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human AKT1
• Uniprot ID: P31749
• Protein Name: RAC-alpha serine/threonine-protein kinase
• Publications:

  The RNA helicase DDX3 induces neural crest by promoting AKT activity. Development. NULL, NULL (2020)

• Protein Accession #: NP_005154
• Purification: Affinity Purified
• Nucleotide Accession #: NM_005163
• Tested Species Reactivity: Human, Frog, Baboon
• Gene Symbol: AKT1
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Pig, Sheep
• Application: WB, IHC
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 100%; Goat: 86%; Human: 100%; Mouse: 100%; Pig: 93%; Rat: 100%; Sheep: 86%
• Image 1: baboon muscle homogenate
  
  WB Suggested Anti-AKT1 Antibody
  Positive Control: Lane 1: 50ug preterm baboon muscle homogenate Lane 2: 50ug preterm baboon muscle homogenate Lane 3: 50ug term baboon muscle homogenate Lane 4: 50ug term baboon muscle homogenate Lane 5: 50ug adult baboon muscle homogenate Lane 6: 50ug adult baboon muscle homogenate
  Primary Antibody Dilution : 1:1666
  Secondary Antibody : Anti-rabbit-HRP
  Secondry Antibody Dilution : 1:1200
  Submitted by: Cynthia Blanco, University of Texas Health Science Center
• Image 2: Xenopus laevis embryos
  
  Lanes:
  1. 50 ug xenopus laevis embryos lysate (lysate buffer) 2. 50 ug xenopus laevis embryos lysate (HB buffer)
  Primary Antibody Dilution:
  1:500
  Secondary Antibody:
  Goat Anti-Rabbit AP
  Secondary Antibody Dilution:
  1:20,000
  Gene Name:
  AKT1
  Submitted by:
  Dr. Rosa Carotenuto, Department of Structural and Functional Biology, University of Naples 'Federico II'
  
• Image 3: Human Small Intestine
  
  WB Suggested Anti-AKT1 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:312500
  Positive Control: Human Small Intestine
• Image 4: Human Lung
  
  Rabbit Anti-AKT1 Antibody
  Catalog Number: AVARP06008_P050
  Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue
  Observed Staining: Cytoplasm, Plasma membrane
  Primary Antibody Concentration: 1:600
  Other Working Concentrations: N/A
  Secondary Antibody: Donkey anti-Rabbit-Cy3
  Secondary Antibody Concentration: 1:200
  Magnification: 20X
  Exposure Time: 0.5 - 2.0 sec