CCNE2 Antibody - N-terminal region (AVARP03044_P050)

Data Sheet
 
Product Number AVARP03044_P050
Product Page www.avivasysbio.com/ccne2-antibody-n-terminal-region-avarp03044-p050.html
Name CCNE2 Antibody - N-terminal region (AVARP03044_P050)
Protein Size (# AA) 404 amino acids
Molecular Weight 47kDa
NCBI Gene Id 9134
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Cyclin E2
Alias Symbols CYCE2
Peptide Sequence Synthetic peptide located within the following region: TTQDVKKRREEVTKKHQYEIRNCWPPVLSGGISPCIIIETPHKEIGTSDF
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Li,T., (2006) Arch. Biochem. Biophys. 453 (1), 70-74
Description of Target The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit
Protein Interactions CDKN1A; CDK2; CDK3; ORC3; CDKN1C; CDKN1B; APP; HIST1H1A; UBC; PTEN; FBXW7; SUMO2; SUMO3;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-CCNE2 (AVARP03044_P050) antibody
Blocking Peptide For anti-CCNE2 (AVARP03044_P050) antibody is Catalog # AAP30167 (Previous Catalog # AAPP00324)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human CCNE2
Uniprot ID O96020
Protein Name G1/S-specific cyclin-E2
Sample Type Confirmation

CCNE2 is supported by BioGPS gene expression data to be expressed in OVCAR3

Protein Accession # NP_477097
Purification Affinity Purified
Nucleotide Accession # NM_057749
Tested Species Reactivity Human
Gene Symbol CCNE2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Guinea Pig, Horse, Pig
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Guinea Pig: 84%; Horse: 100%; Human: 100%; Mouse: 91%; Pig: 92%; Rat: 91%
Image 1
Human OVCAR-3
WB Suggested Anti-CCNE2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: OVCAR-3 cell lysateCCNE2 is supported by BioGPS gene expression data to be expressed in OVCAR3
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com