FOXM1 Antibody - middle region (AVARP03043_P050)

Data Sheet
 
Product Number AVARP03043_P050
Product Page www.avivasysbio.com/foxm1-antibody-middle-region-avarp03043-p050.html
Name FOXM1 Antibody - middle region (AVARP03043_P050)
Protein Size (# AA) 763 amino acids
Molecular Weight 84kDa
NCBI Gene Id 2305
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Forkhead box M1
Alias Symbols MPP2, HFH11, HNF-3, INS-1, MPP-2, PIG29, FKHL16, FOXM1A, FOXM1B, FOXM1C, HFH-11, TRIDENT, MPHOSPH2
Peptide Sequence Synthetic peptide located within the following region: ANRSLTEGLVLDTMNDSLSKILLDISFPGLDEDPLGPDNINWSQFIPELQ
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Laoukili,J., (2008) Mol. Cell. Biol. 28 (9), 3076-3087
Description of Target FOXM1 is a transcriptional activatory factor. It may play a role in the control of cell proliferation
Protein Interactions SMAD3; FZR1; SUMO1; UBE2I; SP1; CDK2; CCNE1; BANP; OS9; HSP90AA1; CDK6; CDK4; DHX29; ACAT1; CDC27; UBC; BCL6; SUMO2; RB1; CREBBP; CDC25B; CDK1; CCNB1; ZBTB3; CHEK2; STAT3; CDH1; CENPF;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-FOXM1 (AVARP03043_P050) antibody
Additional Information IHC Information: Western analysis of Jurkat cell lysate.
Blocking Peptide For anti-FOXM1 (AVARP03043_P050) antibody is Catalog # AAP30353 (Previous Catalog # AAPP00811)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human FOXM1
Uniprot ID Q08050
Protein Name Forkhead box protein M1
Protein Accession # NP_068772
Purification Affinity Purified
Nucleotide Accession # NM_021953
Tested Species Reactivity Human
Gene Symbol FOXM1
Predicted Species Reactivity Human, Mouse, Rat, Dog, Guinea Pig, Rabbit
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Dog: 83%; Guinea Pig: 83%; Human: 100%; Mouse: 91%; Rabbit: 91%; Rat: 91%
Image 1
Human 293T
Host: Rabbit
Target Name: FOXM1
Sample Tissue: Human 293T
Antibody Dilution: 1.0ug/ml
Image 2
Human Jurkat Whole Cell
Host: Rabbit
Target Name: FOXM1
Sample Tissue: Human Jurkat Whole Cell
Antibody Dilution: 1ug/ml
Image 3
Human 786-0 Whole Cell
Host: Rabbit
Target Name: FOXM1
Sample Tissue: Human 786-0 Whole Cell
Antibody Dilution: 1ug/ml
Image 4
Human Spleen
Immunohistochemistry with Spleen cell lysate tissue at an antibody concentration of 5.0ug/ml using anti-FOXM1 antibody (AVARP03043_P050)
Image 5
Human Spleen
Immunohistochemistry with Human Spleen lysate tissue at an antibody concentration of 5.0ug/ml using anti-FOXM1 antibody (AVARP03043_P050)
Image 6
Human
Lanes:
Lane 1: 25ug MIA PaCa-2 human pancreatic cancer cell line Lane 2: 25ug MDA-MB-231 cell lysate
Lane 3: 25ug Huh-7 cell lysate
Primary Antibody Dilution:
1:2000
Secondary Antibody:
Anti-rabbit-HRP
Secondary Antibody Dilution:
1:5000
Gene Name:
FOXM1
Submitted by:
Andrei L. Gartel, University of Illinois at Chicago
Image 7
HepG2, Human stomach
Host: Rabbit
Target: FOXM1
Positive control (+): HepG2 (HG)
Negative control (-): Human stomach (ST)
Antibody concentration: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com