CCNG2 Antibody - N-terminal region (AVARP03032_T100)

Data Sheet
 
Product Number AVARP03032_T100
Product Page www.avivasysbio.com/ccng2-antibody-n-terminal-region-avarp03032-t100.html
Name CCNG2 Antibody - N-terminal region (AVARP03032_T100)
Protein Size (# AA) 344 amino acids
Molecular Weight 39kDa
NCBI Gene Id 901
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Cyclin G2
Peptide Sequence Synthetic peptide located within the following region: MKDLGAEHLAGHEGVQLLGLLNVYLEQEERFQPREKGLSLIEATPENDNT
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Bennin,D.A., et al., (2002) J. Biol. Chem. 277 (30), 27449-27467
Description of Target The eukaryotic cell cycle is governed by cyclin-dependent protein kinases (CDKs) whose activities are regulated by cyclins and CDK inhibitors. The 8 species of cyclins reported in mammals, cyclins A through H, share a conserved amino acid sequence of about 90 residues called the cyclin box. The amino acid sequence of cyclin G is well conserved among mammals. The nucleotide sequence of cyclin G1 and cyclin G2 are 53% identical. Unlike cyclin G1, cyclin G2 contains a C-terminal PEST protein destabilization motif, suggesting that cyclin G2 expression is tightly regulated through the cell cycle.
Protein Interactions EFHC2; FAM208B; NRIP2; UBC; SKP2; SKP1; PPP2CA; PPP2R4; PPP2R5C; PPP2R5B;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-CCNG2 (AVARP03032_T100) antibody
Blocking Peptide For anti-CCNG2 (AVARP03032_T100) antibody is Catalog # AAP30350 (Previous Catalog # AAPP00808)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human CCNG2
Uniprot ID Q16589
Protein Name Cyclin-G2
Protein Accession # NP_004345
Purification Protein A purified
Nucleotide Accession # NM_004354
Tested Species Reactivity Human
Gene Symbol CCNG2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 91%; Dog: 91%; Human: 100%; Mouse: 83%; Rat: 83%
Image 1
Human 293T
Host: Rabbit
Target Name: CCNG2
Sample Tissue: Human 293T
Antibody Dilution: 1.0ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com