Product Number |
AVARP03032_T100 |
Product Page |
www.avivasysbio.com/ccng2-antibody-n-terminal-region-avarp03032-t100.html |
Name |
CCNG2 Antibody - N-terminal region (AVARP03032_T100) |
Protein Size (# AA) |
344 amino acids |
Molecular Weight |
39kDa |
NCBI Gene Id |
901 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Cyclin G2 |
Peptide Sequence |
Synthetic peptide located within the following region: MKDLGAEHLAGHEGVQLLGLLNVYLEQEERFQPREKGLSLIEATPENDNT |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Bennin,D.A., et al., (2002) J. Biol. Chem. 277 (30), 27449-27467 |
Description of Target |
The eukaryotic cell cycle is governed by cyclin-dependent protein kinases (CDKs) whose activities are regulated by cyclins and CDK inhibitors. The 8 species of cyclins reported in mammals, cyclins A through H, share a conserved amino acid sequence of about 90 residues called the cyclin box. The amino acid sequence of cyclin G is well conserved among mammals. The nucleotide sequence of cyclin G1 and cyclin G2 are 53% identical. Unlike cyclin G1, cyclin G2 contains a C-terminal PEST protein destabilization motif, suggesting that cyclin G2 expression is tightly regulated through the cell cycle. |
Protein Interactions |
EFHC2; FAM208B; NRIP2; UBC; SKP2; SKP1; PPP2CA; PPP2R4; PPP2R5C; PPP2R5B; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-CCNG2 (AVARP03032_T100) antibody |
Blocking Peptide |
For anti-CCNG2 (AVARP03032_T100) antibody is Catalog # AAP30350 (Previous Catalog # AAPP00808) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human CCNG2 |
Uniprot ID |
Q16589 |
Protein Name |
Cyclin-G2 |
Protein Accession # |
NP_004345 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_004354 |
Tested Species Reactivity |
Human |
Gene Symbol |
CCNG2 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 91%; Dog: 91%; Human: 100%; Mouse: 83%; Rat: 83% |
Image 1 | Human 293T
| Host: Rabbit Target Name: CCNG2 Sample Tissue: Human 293T Antibody Dilution: 1.0ug/ml |
|
|