| Product Number |
AVARP03021_P050-HRP |
| Product Page |
https://www.avivasysbio.com/ccnt1-antibody-n-terminal-region-hrp-avarp03021-p050-hrp.html |
| Name |
CCNT1 Antibody - N-terminal region : HRP (AVARP03021_P050-HRP) |
| Protein Size (# AA) |
726 amino acids |
| Molecular Weight |
81kDa |
| Conjugation |
HRP: Horseradish Peroxidase |
| NCBI Gene Id |
904 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Cyclin T1 |
| Alias Symbols |
CCNT, CYCT1, HIVE1 |
| Peptide Sequence |
Synthetic peptide located within the following region: EGERKNNNKRWYFTREQLENSPSRRFGVDPDKELSYRQQAANLLQDMGQR |
| Product Format |
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Reference |
Sun,J., (2008) J. Virol. 82 (11), 5562-5572 |
| Description of Target |
CCNT1 belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. This cyclin tightly associates with CDK9 kinase, and was found to be a major subunit of the transcription elongation factor p-TEFb. The kinase complex containing this cyclin and the elongation factor can interact with, and act as a cofactor of human immunodeficiency virus type 1 (HIV-1) Tat protein, and was shown to be both necessary and sufficient for full activation of viral transcription. This cyclin and its kinase partner were also found to be involved in the phosphorylation and regulation of the carboxy-terminal domain (CTD) of the largest RNA polymerase II subunit.The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. This cyclin tightly associates with CDK9 kinase, and was found to be a major subunit of the transcription elongation factor p-TEFb. The kinase complex containing this cyclin and the elongation factor can interact with, and act as a cofactor of human immunodeficiency virus type 1 (HIV-1) Tat protein, and was shown to be both necessary and sufficient for full activation of viral transcription. This cyclin and its kinase partner were also found to be involved in the phosphorylation and regulation of the carboxy-terminal domain (CTD) of the largest RNA polymerase II subunit. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
| Protein Interactions |
tat; LARP7; AFF1; CDK9; BRD4; HEXIM1; UBC; SUMO1; NEDD8; RN7SK; SUPT5H; SOX2; CTD; MBP; AFF4; ELL2; MED26; MLLT3; ESR1; DAB2; CCNT1; BRDT; BARD1; TAF1; RPS9; GNAI3; LEO1; C11orf58; TUBB4B; TP53BP1; KMT2A; UBE2A; POLR2A; GTF2F1; TAF7; Ep300; Gata4; TERF2; |
| Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Datasheets/Manuals |
Printable datasheet for anti-CCNT1 (AVARP03021_P050-HRP) antibody |
| Blocking Peptide |
For anti-CCNT1 (AVARP03021_P050-HRP) antibody is Catalog # AAP30172 (Previous Catalog # AAPS08904) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human CCNT1 |
| Uniprot ID |
O60563 |
| Protein Name |
Cyclin-T1 |
| Sample Type Confirmation |
CCNT1 is supported by BioGPS gene expression data to be expressed in 721_B, HeLa, MCF7 |
| Protein Accession # |
NP_001231 |
| Nucleotide Accession # |
NM_001240 |
| Gene Symbol |
CCNT1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 92%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | |
|
