CCNT1 Antibody - N-terminal region (AVARP03021_P050)

• Product Number: AVARP03021_P050
• Name: CCNT1 Antibody - N-terminal region (AVARP03021_P050)
• Protein Size (# AA): 726 amino acids
• Molecular Weight: 81kDa
• NCBI Gene Id: 904
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Cyclin T1
• Alias Symbols: CCNT, CYCT1, HIVE1
• Peptide Sequence: Synthetic peptide located within the following region: EGERKNNNKRWYFTREQLENSPSRRFGVDPDKELSYRQQAANLLQDMGQR
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Sun,J., (2008) J. Virol. 82 (11), 5562-5572
• Description of Target: CCNT1 belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. This cyclin tightly associates with CDK9 kinase, and was found to be a major subunit of the transcription elongation factor p-TEFb. The kinase complex containing this cyclin and the elongation factor can interact with, and act as a cofactor of human immunodeficiency virus type 1 (HIV-1) Tat protein, and was shown to be both necessary and sufficient for full activation of viral transcription. This cyclin and its kinase partner were also found to be involved in the phosphorylation and regulation of the carboxy-terminal domain (CTD) of the largest RNA polymerase II subunit.The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. This cyclin tightly associates with CDK9 kinase, and was found to be a major subunit of the transcription elongation factor p-TEFb. The kinase complex containing this cyclin and the elongation factor can interact with, and act as a cofactor of human immunodeficiency virus type 1 (HIV-1) Tat protein, and was shown to be both necessary and sufficient for full activation of viral transcription. This cyclin and its kinase partner were also found to be involved in the phosphorylation and regulation of the carboxy-terminal domain (CTD) of the largest RNA polymerase II subunit. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Protein Interactions: tat; LARP7; AFF1; CDK9; BRD4; HEXIM1; UBC; SUMO1; NEDD8; RN7SK; SUPT5H; SOX2; CTD; MBP; AFF4; ELL2; MED26; MLLT3; ESR1; DAB2; CCNT1; BRDT; BARD1; TAF1; RPS9; GNAI3; LEO1; C11orf58; TUBB4B; TP53BP1; KMT2A; UBE2A; POLR2A; GTF2F1; TAF7; Ep300; Gata4; TERF2;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-CCNT1 (AVARP03021_P050) antibody is Catalog # AAP30172 (Previous Catalog # AAPS08904)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CCNT1
• Uniprot ID: O60563
• Protein Name: Cyclin-T1
• Sample Type Confirmation:

  CCNT1 is supported by BioGPS gene expression data to be expressed in 721_B, HeLa, MCF7

• Protein Accession #: NP_001231
• Purification: Affinity Purified
• Nucleotide Accession #: NM_001240
• Tested Species Reactivity: Human
• Gene Symbol: CCNT1
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 92%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
• Image 1: Human 721_B
  
  WB Suggested Anti-CCNT1 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:1562500
  Positive Control: 721_B cell lysateCCNT1 is supported by BioGPS gene expression data to be expressed in 721_B
• Image 2: Human MCF7
  
  Host: Rabbit
  Target Name: CCNT1
  Sample Type: MCF7
  Antibody Dilution: 1.0ug/mlCCNT1 is supported by BioGPS gene expression data to be expressed in MCF7
• Image 3: Human Hela
  
  Host: Rabbit
  Target Name: CCNT1
  Sample Type: Hela
  Antibody Dilution: 1.0ug/mlCCNT1 is supported by BioGPS gene expression data to be expressed in HeLa