PCNA Antibody - C-terminal region (AVARP03018_T100)

• Product Number: AVARP03018_T100
• Name: PCNA Antibody - C-terminal region (AVARP03018_T100)
• Protein Size (# AA): 261 amino acids
• Molecular Weight: 29kDa
• NCBI Gene Id: 5111
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Proliferating cell nuclear antigen
• Alias Symbols: ATLD2
• Peptide Sequence: Synthetic peptide located within the following region: LNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEGS
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Senga,T., (2006) J. Biol. Chem. 281 (10), 6246-6252
• Description of Target: PCNA is an auxiliary protein of DNA polymerase delta and is involved in the control of eukaryotic DNA replication by increasing the polymerase's processibility during elongation of the leading strand.The protein encoded by this gene is found in the nucleus and is a cofactor of DNA polymerase delta. The encoded protein acts as a homotrimer and helps increase the processivity of leading strand synthesis during DNA replication. In response to DNA damage, this protein is ubiquitinated and is involved in the RAD6-dependent DNA repair pathway. Two transcript variants encoding the same protein have been found for this gene. Pseudogenes of this gene have been described on chromosome 4 and on the X chromosome.
• Protein Interactions: GADD45A; CDKN1A; HUWE1; POLH; PCNA; MSH3; FUS; UBC; TMEM218; CHFR; DTL; POLE; POLD1; MCM7; MCM4; LIG1; MSH6; FEN1; FBXO18; ZRANB3; CHTF18; DNMT1; RAD18; SIVA1; KIAA0101; TDG; SUMO2; SUMO3; RPA1; RFC5; RFC4; RFC3; RFC2; RFC1; MDM2; TRIM25; USP18; ISG15; MA
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-PCNA (AVARP03018_T100) antibody is Catalog # AAP30202 (Previous Catalog # AAPS09007)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human PCNA
• Uniprot ID: P12004
• Protein Name: Proliferating cell nuclear antigen
• Publications:

  Liu, Z. et al. Human umbilical cord mesenchymal stromal cells rescue mice from acetaminophen-induced acute liver failure. Cytotherapy 16, 1207-19 (2014). 25108650

• Sample Type Confirmation:

  PCNA is supported by BioGPS gene expression data to be expressed in HepG2

• Protein Accession #: NP_002583
• Purification: Protein A purified
• Nucleotide Accession #: NM_002592
• Tested Species Reactivity: Human
• Gene Symbol: PCNA
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Zebrafish
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 91%
• Image 1: Human HepG2
  
  WB Suggested Anti-PCNA Antibody Titration: 1.25ug/ml
  Positive Control: HepG2 cell lysatePCNA is supported by BioGPS gene expression data to be expressed in HepG2
• Image 2: Human Spleen
  
  Rabbit Anti-PCNA Antibody
  Catalog Number: AVARP03018
  Paraffin Embedded Tissue: Human Spleen
  Cellular Data: Spleen cells
  Antibody Concentration: 4.0-8.0 ug/ml
  Magnification: 400X
• Image 3: Human brain stem
  
  Researcher: Dr. Yuzhi Chen, University of Arkansas for Medical Science
  Application: IHC
  Species+tissue/cell type: Human brain stem cells
  Primary antibody dilution: 1:500
  Secondary antibody: Goat anti-rabbit Alexa-Fluor 594
  Secondary antibody dilution: 1:1000
• Image 4: Human NT-2
  
  Sample Type: 1. Human NT-2 cells (60ug)
  Primary antibody dilution: 2ug/ml
  Secondary antibody: IRDye 800CW goat anti-rabbit from Li-COR Bioscience
  Secondary antibody dilution: 1: 20,000
  Image Submitted by: Yuzhi ChenUniversity of Arkansas for Medical Science
• Image 5: Human NT-2
  
  Data Provided by Dr. Yuzhi Chen, University of Arkansas for Medical SciencesNT2 cells were pretreated with 2N HCL for 30 minutesWashed 3x in PBSStained for 2 hours with 1ug/50ul antibodyand Incubated in Alexa goat-rabbit 594 for 1H.Images were obtained with a 40x objectiveNT-2 cellsAntibody: RedDAPI: Blue