TNFRSF25 Antibody - middle region (AVARP02066_P050)

• Product Number: AVARP02066_P050
• Name: TNFRSF25 Antibody - middle region (AVARP02066_P050)
• Protein Size (# AA): 372 amino acids
• Molecular Weight: 38kDa
• NCBI Gene Id: 8718
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Tumor necrosis factor receptor superfamily, member 25
• Alias Symbols: DR3, TR3, DDR3, LARD, APO-3, TRAMP, WSL-1, GEF720, WSL-LR, PLEKHG5, TNFRSF12
• Peptide Sequence: Synthetic peptide located within the following region: GRFRDQQYEMLKRWRQQQPAGLGAVYAALERMGLDGCVEDLRSRLQRGP
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Borysenko,C.W., (2006) J. Cell. Physiol. 209 (3), 1021-1028
• Description of Target: TNFRSF25 is a member of the TNF-receptor superfamily. This receptor is expressed preferentially in the tissues enriched in lymphocytes, and it may play a role in regulating lymphocyte homeostasis. This receptor has been shown to stimulate NF-kappa B activity and regulate cell apoptosis. The signal transduction of this receptor is mediated by various death domain containing adaptor proteins. Knockout studies in mice suggested the role of this gene in the removal of self-reactive T cells in the thymus. Multiple alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported, most of which are potentially secreted molecules. The alternative splicing of this gene in B and T cells encounters a programmed change upon T-cell activation, which predominantly produces full-length, membrane bound isoforms, and is thought to be involved in controlling lymphocyte proliferation induced by T-cell activation.The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is expressed preferentially in the tissues enriched in lymphocytes, and it may play a role in regulating lymphocyte homeostasis. This receptor has been shown to stimulate NF-kappa B activity and regulate cell apoptosis. The signal transduction of this receptor is mediated by various death domain containing adaptor proteins. Knockout studies in mice suggested the role of this gene in the removal of self-reactive T cells in the thymus. Multiple alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported, most of which are potentially secreted molecules. The alternative splicing of this gene in B and T cells encounters a programmed change upon T-cell activation, which predominantly produces full-length, membrane bound isoforms, and is thought to be involved in controlling lymphocyte proliferation induced by T-cell activation.
• Protein Interactions: RIPK1; TRADD; UBC; TRAF2; MAPK1; TNFSF15; BAG4; TNFSF12; TNFRSF1A; TNFRSF25; NOL3; DAP3;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-TNFRSF25 (AVARP02066_P050) antibody is Catalog # AAP30625 (Previous Catalog # AAPP01278)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TNFRSF25
• Uniprot ID: Q93038
• Protein Name: Tumor necrosis factor receptor superfamily member 25
• Protein Accession #: NP_683868
• Purification: Affinity Purified
• Nucleotide Accession #: NM_148967
• Tested Species Reactivity: Human
• Gene Symbol: TNFRSF25
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
• Image 1: Human HepG2
  
  WB Suggested Anti-TNFRSF25 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:500
  Positive Control: HepG2 cell lysate