TNFRSF25 Antibody - middle region (AVARP02066_P050)

Data Sheet
 
Product Number AVARP02066_P050
Product Page www.avivasysbio.com/tnfrsf25-antibody-middle-region-avarp02066-p050.html
Name TNFRSF25 Antibody - middle region (AVARP02066_P050)
Protein Size (# AA) 372 amino acids
Molecular Weight 38kDa
NCBI Gene Id 8718
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Tumor necrosis factor receptor superfamily, member 25
Alias Symbols DR3, TR3, DDR3, LARD, APO-3, TRAMP, WSL-1, GEF720, WSL-LR, PLEKHG5, TNFRSF12
Peptide Sequence Synthetic peptide located within the following region: GRFRDQQYEMLKRWRQQQPAGLGAVYAALERMGLDGCVEDLRSRLQRGP
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Borysenko,C.W., (2006) J. Cell. Physiol. 209 (3), 1021-1028
Description of Target TNFRSF25 is a member of the TNF-receptor superfamily. This receptor is expressed preferentially in the tissues enriched in lymphocytes, and it may play a role in regulating lymphocyte homeostasis. This receptor has been shown to stimulate NF-kappa B activity and regulate cell apoptosis. The signal transduction of this receptor is mediated by various death domain containing adaptor proteins. Knockout studies in mice suggested the role of this gene in the removal of self-reactive T cells in the thymus. Multiple alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported, most of which are potentially secreted molecules. The alternative splicing of this gene in B and T cells encounters a programmed change upon T-cell activation, which predominantly produces full-length, membrane bound isoforms, and is thought to be involved in controlling lymphocyte proliferation induced by T-cell activation.The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is expressed preferentially in the tissues enriched in lymphocytes, and it may play a role in regulating lymphocyte homeostasis. This receptor has been shown to stimulate NF-kappa B activity and regulate cell apoptosis. The signal transduction of this receptor is mediated by various death domain containing adaptor proteins. Knockout studies in mice suggested the role of this gene in the removal of self-reactive T cells in the thymus. Multiple alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported, most of which are potentially secreted molecules. The alternative splicing of this gene in B and T cells encounters a programmed change upon T-cell activation, which predominantly produces full-length, membrane bound isoforms, and is thought to be involved in controlling lymphocyte proliferation induced by T-cell activation.
Protein Interactions RIPK1; TRADD; UBC; TRAF2; MAPK1; TNFSF15; BAG4; TNFSF12; TNFRSF1A; TNFRSF25; NOL3; DAP3;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-TNFRSF25 (AVARP02066_P050) antibody
Blocking Peptide For anti-TNFRSF25 (AVARP02066_P050) antibody is Catalog # AAP30625 (Previous Catalog # AAPP01278)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human TNFRSF25
Uniprot ID Q93038
Protein Name Tumor necrosis factor receptor superfamily member 25
Protein Accession # NP_683868
Purification Affinity Purified
Nucleotide Accession # NM_148967
Tested Species Reactivity Human
Gene Symbol TNFRSF25
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Image 1
Human HepG2
WB Suggested Anti-TNFRSF25 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:500
Positive Control: HepG2 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com