YWHAE Antibody - middle region (AVARP02058_P050)

Data Sheet
 
Product Number AVARP02058_P050
Product Page www.avivasysbio.com/ywhae-antibody-middle-region-avarp02058-p050.html
Name YWHAE Antibody - middle region (AVARP02058_P050)
Protein Size (# AA) 255 amino acids
Molecular Weight 29kDa
NCBI Gene Id 7531
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide
Alias Symbols MDS, HEL2, MDCR, KCIP-1, 14-3-3E
Peptide Sequence Synthetic peptide located within the following region: ELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGEEQNKEALQDVEDEN
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Tak,H., (2007) Cell. Signal. 19 (11), 2379-2387
Description of Target YWHAE is an adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathway. YWHAE binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. The binding generally results in the modulation of the activity of the binding partner.This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 100% identical to the mouse ortholog. It interacts with CDC25 phosphatases, RAF1 and IRS1 proteins, suggesting its role in diverse biochemical activities related to signal transduction, such as cell division and regulation of insulin sensitivity. It has also been implicated in the pathogenesis of small cell lung cancer. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Interactions DTL; HUWE1; FAM53C; FBXW11; SORBS2; UBC; ABL1; GRB10; SIK2; CEP57; SIK3; TP53; IRS4; CBL; TUBB2A; TWF2; PROSC; FERMT2; PDIA4; RAP1GDS1; PTMA; PPP1R2; PDHB; PAK2; PAFAH1B2; YWHAH; XPO1; VCL; GSS; G6PD; EIF5; TBCB; CAPNS1; CAPN2; ALDH7A1; ATIC; ASNS; SCPEP1
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-YWHAE (AVARP02058_P050) antibody
Blocking Peptide For anti-YWHAE (AVARP02058_P050) antibody is Catalog # AAP30642 (Previous Catalog # AAPP01295)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human YWHAE
Uniprot ID P62258
Protein Name 14-3-3 protein epsilon
Protein Accession # NP_006752
Purification Affinity Purified
Nucleotide Accession # NM_006761
Tested Species Reactivity Human
Gene Symbol YWHAE
Predicted Species Reactivity Mouse, Dog, Guinea Pig, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Dog: 100%; Guinea Pig: 100%; Mouse: 100%; Zebrafish: 100%
Image 1
Human Spleen
WB Suggested Anti-YWHAE Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: Human Spleen
Image 2
Human NT-2, mouse brain extracts
Sample Type: 1. Human NT-2 cells (60ug)
2. mouse brain extracts (80ug)
Primary Antibody Dilution: 2ug/ml
Secondary Antibody: IRDye 800CW goat anti-rabbit from Li-COR Bioscience
Secondary Antibody Dilution: 1: 20,000
Image Submitted by: Yuzhi Chen
University of Arkansas for Medical Science 
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com