TNFRSF18 Antibody - C-terminal region (AVARP02052_T100)

Data Sheet
 
Product Number AVARP02052_T100
Product Page www.avivasysbio.com/tnfrsf18-antibody-c-terminal-region-avarp02052-t100.html
Name TNFRSF18 Antibody - C-terminal region (AVARP02052_T100)
Protein Size (# AA) 234 amino acids
Molecular Weight 23kDa
NCBI Gene Id 8784
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Tumor necrosis factor receptor superfamily, member 18
Alias Symbols AITR, GITR, CD357, GITR-D, ENERGEN
Peptide Sequence Synthetic peptide located within the following region: LHIWQLRKTQLLLEVPPSTEDARSCQFPEEERGERSAEEKGRLGDLWV
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Liu,B., (2008) J. Biol. Chem. 283 (13), 8202-8210
Description of Target The protein encoded by TNFRSF18 is a member of the TNF-receptor superfamily. This receptor has been shown to have increased expression upon T-cell activation, and it is thought to play a key role in dominant immunological self-tolerance maintained by CD25(+)CD4(+) regulatory T cells. Knockout studies in mice also suggest the role of this receptor is in the regulation of CD3-driven T-cell activation and programmed cell death.The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor has been shown to have increased expression upon T-cell activation, and it is thought to play a key role in dominant immunological self-tolerance maintained by CD25(+)CD4(+) regulatory T cells. Knockout studies in mice also suggest the role of this receptor is in the regulation of CD3-driven T-cell activation and programmed cell death. Three alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported.
Protein Interactions LNX1; TRAF3; TRAF2; TRAF1; TNFSF18; TNFRSF18;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-TNFRSF18 (AVARP02052_T100) antibody
Blocking Peptide For anti-TNFRSF18 (AVARP02052_T100) antibody is Catalog # AAPS23201
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human TNFRSF18
Uniprot ID B1AME3
Protein Name Tumor necrosis factor receptor superfamily, member 18 EMBL CAI23248.1
Protein Accession # NP_683700
Purification Protein A purified
Nucleotide Accession # NM_148902
Tested Species Reactivity Human
Gene Symbol TNFRSF18
Predicted Species Reactivity Human
Application WB
Predicted Homology Based on Immunogen Sequence Human: 100%
Image 1
Human HCT116
Host: Rabbit
Target Name: TNFRSF18
Sample Tissue: Human HCT116
Antibody Dilution: 1.0ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com