Product Number |
AVARP02052_T100 |
Product Page |
www.avivasysbio.com/tnfrsf18-antibody-c-terminal-region-avarp02052-t100.html |
Name |
TNFRSF18 Antibody - C-terminal region (AVARP02052_T100) |
Protein Size (# AA) |
234 amino acids |
Molecular Weight |
23kDa |
NCBI Gene Id |
8784 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Tumor necrosis factor receptor superfamily, member 18 |
Alias Symbols |
AITR, GITR, CD357, GITR-D, ENERGEN |
Peptide Sequence |
Synthetic peptide located within the following region: LHIWQLRKTQLLLEVPPSTEDARSCQFPEEERGERSAEEKGRLGDLWV |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Liu,B., (2008) J. Biol. Chem. 283 (13), 8202-8210 |
Description of Target |
The protein encoded by TNFRSF18 is a member of the TNF-receptor superfamily. This receptor has been shown to have increased expression upon T-cell activation, and it is thought to play a key role in dominant immunological self-tolerance maintained by CD25(+)CD4(+) regulatory T cells. Knockout studies in mice also suggest the role of this receptor is in the regulation of CD3-driven T-cell activation and programmed cell death.The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor has been shown to have increased expression upon T-cell activation, and it is thought to play a key role in dominant immunological self-tolerance maintained by CD25(+)CD4(+) regulatory T cells. Knockout studies in mice also suggest the role of this receptor is in the regulation of CD3-driven T-cell activation and programmed cell death. Three alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported. |
Protein Interactions |
LNX1; TRAF3; TRAF2; TRAF1; TNFSF18; TNFRSF18; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-TNFRSF18 (AVARP02052_T100) antibody |
Blocking Peptide |
For anti-TNFRSF18 (AVARP02052_T100) antibody is Catalog # AAPS23201 |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human TNFRSF18 |
Uniprot ID |
B1AME3 |
Protein Name |
Tumor necrosis factor receptor superfamily, member 18 EMBL CAI23248.1 |
Protein Accession # |
NP_683700 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_148902 |
Tested Species Reactivity |
Human |
Gene Symbol |
TNFRSF18 |
Predicted Species Reactivity |
Human |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Human: 100% |
Image 1 | Human HCT116
| Host: Rabbit Target Name: TNFRSF18 Sample Tissue: Human HCT116 Antibody Dilution: 1.0ug/ml |
|
|