WDR3 Antibody - middle region (AVARP02043_P050)

Data Sheet
 
Product Number AVARP02043_P050
Product Page www.avivasysbio.com/wdr3-antibody-middle-region-avarp02043-p050.html
Name WDR3 Antibody - middle region (AVARP02043_P050)
Protein Size (# AA) 943 amino acids
Molecular Weight 106kDa
NCBI Gene Id 10885
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name WD repeat domain 3
Alias Symbols DIP2, UTP12
Peptide Sequence Synthetic peptide located within the following region: VIGFNMAGLDYLKRECEAKSEVMFFADATSHLEEKKRKRKKREKLILTLT
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Nousiainen,M., (2006) Proc. Natl. Acad. Sci. U.S.A. 103 (14), 5391-5396
Description of Target WDR3 is a nuclear protein containing 10 WD repeats. WD repeats are approximately 30- to 40-amino acid domains containing several conserved residues, which usually include a trp-asp at the C-terminal end. Proteins belonging to the WD repeat family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation.This gene encodes a nuclear protein containing 10 WD repeats. WD repeats are approximately 30- to 40-amino acid domains containing several conserved residues, which usually include a trp-asp at the C-terminal end. Proteins belonging to the WD repeat family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation.
Protein Interactions UBC; RPA3; RPA2; RPA1; EED; rev; SOX2; PNO1; BYSL; SIRT7; SUMO2; USP43; USP36; PDE10A;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-WDR3 (AVARP02043_P050) antibody
Blocking Peptide For anti-WDR3 (AVARP02043_P050) antibody is Catalog # AAP30640 (Previous Catalog # AAPP01293)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human WDR3
Uniprot ID Q9UNX4
Protein Name WD repeat-containing protein 3
Sample Type Confirmation

WDR3 is supported by BioGPS gene expression data to be expressed in HeLa

Protein Accession # NP_006775
Purification Affinity Purified
Nucleotide Accession # NM_006784
Tested Species Reactivity Human
Gene Symbol WDR3
Predicted Species Reactivity Human, Rat, Cow, Guinea Pig, Horse, Pig, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Pig: 100%; Rabbit: 100%; Rat: 80%; Zebrafish: 78%
Image 1
Human HeLa
WB Suggested Anti-WDR3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Hela cell lysateWDR3 is supported by BioGPS gene expression data to be expressed in HeLa
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com