Product Number |
AVARP02043_P050 |
Product Page |
www.avivasysbio.com/wdr3-antibody-middle-region-avarp02043-p050.html |
Name |
WDR3 Antibody - middle region (AVARP02043_P050) |
Protein Size (# AA) |
943 amino acids |
Molecular Weight |
106kDa |
NCBI Gene Id |
10885 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
WD repeat domain 3 |
Alias Symbols |
DIP2, UTP12 |
Peptide Sequence |
Synthetic peptide located within the following region: VIGFNMAGLDYLKRECEAKSEVMFFADATSHLEEKKRKRKKREKLILTLT |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Nousiainen,M., (2006) Proc. Natl. Acad. Sci. U.S.A. 103 (14), 5391-5396 |
Description of Target |
WDR3 is a nuclear protein containing 10 WD repeats. WD repeats are approximately 30- to 40-amino acid domains containing several conserved residues, which usually include a trp-asp at the C-terminal end. Proteins belonging to the WD repeat family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation.This gene encodes a nuclear protein containing 10 WD repeats. WD repeats are approximately 30- to 40-amino acid domains containing several conserved residues, which usually include a trp-asp at the C-terminal end. Proteins belonging to the WD repeat family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. |
Protein Interactions |
UBC; RPA3; RPA2; RPA1; EED; rev; SOX2; PNO1; BYSL; SIRT7; SUMO2; USP43; USP36; PDE10A; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-WDR3 (AVARP02043_P050) antibody |
Blocking Peptide |
For anti-WDR3 (AVARP02043_P050) antibody is Catalog # AAP30640 (Previous Catalog # AAPP01293) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human WDR3 |
Uniprot ID |
Q9UNX4 |
Protein Name |
WD repeat-containing protein 3 |
Sample Type Confirmation |
WDR3 is supported by BioGPS gene expression data to be expressed in HeLa |
Protein Accession # |
NP_006775 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_006784 |
Tested Species Reactivity |
Human |
Gene Symbol |
WDR3 |
Predicted Species Reactivity |
Human, Rat, Cow, Guinea Pig, Horse, Pig, Rabbit, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Pig: 100%; Rabbit: 100%; Rat: 80%; Zebrafish: 78% |
Image 1 | Human HeLa
| WB Suggested Anti-WDR3 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:1562500 Positive Control: Hela cell lysateWDR3 is supported by BioGPS gene expression data to be expressed in HeLa |
|