| Product Number |
AVARP02039_P050 |
| Product Page |
www.avivasysbio.com/tnfrsf10c-antibody-n-terminal-region-avarp02039-p050.html |
| Name |
TNFRSF10C Antibody - N-terminal region (AVARP02039_P050) |
| Protein Size (# AA) |
259 amino acids |
| Molecular Weight |
25kDa |
| NCBI Gene Id |
8794 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Tumor necrosis factor receptor superfamily, member 10c, decoy without an intracellular domain |
| Alias Symbols |
LIT, DCR1, TRID, CD263, TRAILR3, TRAIL-R3, DCR1-TNFR |
| Peptide Sequence |
Synthetic peptide located within the following region: MARIPKTLKFVVVIVAVLLPVLAYSATTARQEEVPQQTVAPQQQRHSFKG |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Inagaki,S., (2007) Biosci. Biotechnol. Biochem. 71 (8), 2065-2068 |
| Description of Target |
TNFRSF10C is the receptor for the cytotoxic ligand TRAIL. TNFRSF10C lacks a cytoplasmic death domain and hence is not capable of inducing apoptosis. TNFRSF10C may protect cells against TRAIL mediated apoptosis by competing with TRAIL-R1 and R2 for binding to the ligand.The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor contains an extracellular TRAIL-binding domain and a transmembrane domain, but no cytoplasmic death domain. This receptor is not capable of inducing apoptosis, and is thought to function as an antagonistic receptor that protects cells from TRAIL-induced apoptosis. This gene was found to be a p53-regulated DNA damage-inducible gene. The expression of this gene was detected in many normal tissues but not in most cancer cell lines, which may explain the specific sensitivity of cancer cells to the apoptosis-inducing activity of TRAIL. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
| Protein Interactions |
SRPK2; SRPK1; BMX; FAM101B; LRSAM1; ZHX1; SLC27A6; TNFSF10; APOA1; RAP1A; TP53; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-TNFRSF10C (AVARP02039_P050) antibody |
| Blocking Peptide |
For anti-TNFRSF10C (AVARP02039_P050) antibody is Catalog # AAP30623 (Previous Catalog # AAPP01276) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human TNFRSF10C |
| Uniprot ID |
O14798 |
| Protein Name |
Tumor necrosis factor receptor superfamily member 10C |
| Protein Accession # |
NP_003832 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_003841 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
TNFRSF10C |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100% |
| Image 1 | Human Stomach
 | WB Suggested Anti-TNFRSF10C Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Stomach |
|
|
