Product Number |
AVARP02028_P050 |
Product Page |
www.avivasysbio.com/stk17a-antibody-c-terminal-region-avarp02028-p050.html |
Name |
STK17A Antibody - C-terminal region (AVARP02028_P050) |
Protein Size (# AA) |
414 amino acids |
Molecular Weight |
46kDa |
NCBI Gene Id |
9263 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Serine/threonine kinase 17a |
Alias Symbols |
DRAK1 |
Peptide Sequence |
Synthetic peptide located within the following region: KESIVTEELIVVTSYTLGQCRQSEKEKMEQKAISKRFKFEEPLLQEIPGE |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Sanjo,H., (1998) J. Biol. Chem. 273 (44), 29066-29071 |
Description of Target |
STK17A belongs to the protein kinase superfamily, CAMK Ser/Thr protein kinase family, DAP kinase subfamily. It contains 1 protein kinase domain. STK17A acts as a positive regulator of apoptosis.This gene is a member of the DAP kinase-related apoptosis-inducing protein kinase family and encodes an autophosphorylated nuclear protein with a protein kinase domain. The protein has apoptosis-inducing activity. |
Protein Interactions |
UBC; STK17A; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-STK17A (AVARP02028_P050) antibody |
Blocking Peptide |
For anti-STK17A (AVARP02028_P050) antibody is Catalog # AAP30516 (Previous Catalog # AAPP01152) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human STK17A |
Uniprot ID |
Q9UEE5 |
Protein Name |
Serine/threonine-protein kinase 17A |
Protein Accession # |
NP_004751 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_004760 |
Tested Species Reactivity |
Human |
Gene Symbol |
STK17A |
Predicted Species Reactivity |
Cow, Dog, Guinea Pig, Horse |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100% |
Image 1 | Human 293T
| WB Suggested Anti-STK17A Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: 293T cell lysate |
|
|