STK17A Antibody - C-terminal region (AVARP02028_P050)

Data Sheet
 
Product Number AVARP02028_P050
Product Page www.avivasysbio.com/stk17a-antibody-c-terminal-region-avarp02028-p050.html
Name STK17A Antibody - C-terminal region (AVARP02028_P050)
Protein Size (# AA) 414 amino acids
Molecular Weight 46kDa
NCBI Gene Id 9263
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Serine/threonine kinase 17a
Alias Symbols DRAK1
Peptide Sequence Synthetic peptide located within the following region: KESIVTEELIVVTSYTLGQCRQSEKEKMEQKAISKRFKFEEPLLQEIPGE
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Sanjo,H., (1998) J. Biol. Chem. 273 (44), 29066-29071
Description of Target STK17A belongs to the protein kinase superfamily, CAMK Ser/Thr protein kinase family, DAP kinase subfamily. It contains 1 protein kinase domain. STK17A acts as a positive regulator of apoptosis.This gene is a member of the DAP kinase-related apoptosis-inducing protein kinase family and encodes an autophosphorylated nuclear protein with a protein kinase domain. The protein has apoptosis-inducing activity.
Protein Interactions UBC; STK17A;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-STK17A (AVARP02028_P050) antibody
Blocking Peptide For anti-STK17A (AVARP02028_P050) antibody is Catalog # AAP30516 (Previous Catalog # AAPP01152)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human STK17A
Uniprot ID Q9UEE5
Protein Name Serine/threonine-protein kinase 17A
Protein Accession # NP_004751
Purification Affinity Purified
Nucleotide Accession # NM_004760
Tested Species Reactivity Human
Gene Symbol STK17A
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%
Image 1
Human 293T
WB Suggested Anti-STK17A Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 293T cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com