AIFM1 Antibody - middle region (AVARP02013_P050)

• Product Number: AVARP02013_P050
• Name: AIFM1 Antibody - middle region (AVARP02013_P050)
• Protein Size (# AA): 613 amino acids
• Molecular Weight: 67kDa
• NCBI Gene Id: 9131
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Apoptosis-inducing factor, mitochondrion-associated, 1
• Alias Symbols: AIF, AUNX1, CMT2D, CMTX4, COWCK, DFNX5, NADMR, NAMSD, PDCD8, COXPD6, SEMDHL
• Peptide Sequence: Synthetic peptide located within the following region: VIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNIHED
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Desmots,F., (2008) J. Biol. Chem. 283 (6), 3264-3271
• Description of Target: AIFM1 is a flavoprotein essential for nuclear disassembly in apoptotic cells that is found in the mitochondrial intermembrane space in healthy cells. Induction of apoptosis results in the translocation of this protein to the nucleus where it effects chromosome condensation and fragmentation. In addition, this protein induces mitochondria to release the apoptogenic proteins cytochrome c and caspase-9. Several alternative transcripts encoding different isoforms have been identified for this gene.This gene encodes a flavoprotein essential for nuclear disassembly in apoptotic cells that is found in the mitochondrial intermembrane space in healthy cells. Induction of apoptosis results in the translocation of this protein to the nucleus where it effects chromosome condensation and fragmentation. In addition, this gene product induces mitochondria to release the apoptogenic proteins cytochrome c and caspase-9. Three alternative transcripts encoding different isoforms have been identified for this gene.
• Protein Interactions: ISG15; STAU1; BAG6; UBC; NEDD8; MDM2; ASB12; RNF2; BMI1; SUZ12; PARK2; BAG3; ADRB2; HDAC11; OXSR1; ILK; PAN2; NOS2; MLH1; CFTR; ESR1; TST; FSCN1; CPOX; SHC1; FBXO6; TSC22D4; CAND1; COPS5; CUL1; CUL2; CUL3; CUL5; TONSL; BLNK; PIDD1; XIAP; AMFR; Tubb4b; Tub
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-AIFM1 (AVARP02013_P050) antibody is Catalog # AAP30425 (Previous Catalog # AAPP01008)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human AIFM1
• Uniprot ID: O95831
• Protein Name: Apoptosis-inducing factor 1, mitochondrial
• Sample Type Confirmation:

  AIFM1 is supported by BioGPS gene expression data to be expressed in Jurkat

• Protein Accession #: NP_004199
• Purification: Affinity Purified
• Nucleotide Accession #: NM_004208
• Tested Species Reactivity: Human, Mouse, Rat
• Gene Symbol: AIFM1
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
• Image 1: rat aorta
  
  WB Suggested Anti-AIFM1 Antibody
  Titration: 1 ug/ml
  Positive Control: Rat tissue
• Image 2: Human Jurkat
  
  WB Suggested Anti-AIFM1 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:1562500
  Positive Control: Jurkat cell lysateAIFM1 is supported by BioGPS gene expression data to be expressed in Jurkat
• Image 3: Mouse Heart
  
  Host: Mouse
  Target Name: AIFM1
  Sample Tissue: Mouse Heart
  Antibody Dilution: 1ug/ml
• Image 4: Mouse Heart
  
  Host: Rabbit
  Target Name: AIFM1
  Sample Tissue: Mouse Heart
  Antibody Dilution: 1ug/ml