| Product Number |
AVARP00033_T100 |
| Product Page |
www.avivasysbio.com/tnfrsf11b-antibody-n-terminal-region-avarp00033-t100.html |
| Name |
TNFRSF11B Antibody - N-terminal region (AVARP00033_T100) |
| Protein Size (# AA) |
401 amino acids |
| Molecular Weight |
46kDa |
| NCBI Gene Id |
4982 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Tumor necrosis factor receptor superfamily, member 11b |
| Alias Symbols |
OPG, TR1, OCIF, PDB5 |
| Peptide Sequence |
Synthetic peptide located within the following region: LDISIKWTTQETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTV |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Cross,S.S., et al., (2006) Int. J. Cancer 118 (8), 1901-1908 |
| Description of Target |
TNFRSF11B is a member of the TNF-receptor superfamily. This protein is an osteoblast-secreted decoy receptor that functions as a negative regulator of bone resorption. This protein specifically binds to its ligand, osteoprotegerin ligand (TNFSF11/OPGL), both of which are key extracellular regulators of osteoclast development. Studies of the mouse counterpart also suggest this protein and its ligand play a role in lymph-node organogenesis and vascular calcification. Alternatively spliced transcript variants of this gene have been reported, but their full length nature has not been determined. |
| Protein Interactions |
TNFSF13; TNFSF10; TNFSF11; VWF; VTN; THBS1; FN1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-TNFRSF11B (AVARP00033_T100) antibody |
| Blocking Peptide |
For anti-TNFRSF11B (AVARP00033_T100) antibody is Catalog # AAP30520 (Previous Catalog # AAPP01156) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human TNFRSF11B |
| Uniprot ID |
O00300 |
| Protein Name |
Tumor necrosis factor receptor superfamily member 11B |
| Protein Accession # |
NP_002537 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_002546 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
TNFRSF11B |
| Predicted Species Reactivity |
Human, Mouse, Rat, Dog, Horse, Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Dog: 78%; Horse: 78%; Human: 100%; Mouse: 85%; Pig: 78%; Rabbit: 78%; Rat: 78% |
| Image 1 | Human HepG2
 | WB Suggested Anti-TNFRSF11B Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate |
|
|
