Product Number |
AVARP00029_P050 |
Product Page |
www.avivasysbio.com/plagl1-antibody-n-terminal-region-avarp00029-p050.html |
Name |
PLAGL1 Antibody - N-terminal region (AVARP00029_P050) |
Protein Size (# AA) |
463 amino acids |
Molecular Weight |
51 kDa |
NCBI Gene Id |
5325 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Pleiomorphic adenoma gene-like 1 |
Alias Symbols |
ZAC, LOT1, ZAC1 |
Peptide Sequence |
Synthetic peptide located within the following region: FNRKDHLKNHLQTHDPNKMAFGCEECGKKYNTMLGYKRHLALHAASSGDL |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Lemeta,S., (2007) J. Neuropathol. Exp. Neurol. 66 (9), 860-867 |
Description of Target |
PLAGL1 is a C2H2 zinc finger protein with transactivation and DNA-binding activity. This gene has been shown to exhibit antiproliferative activities and is a tumor suppressor gene candidate.This gene encodes a C2H2 zinc finger protein with transactivation and DNA-binding activity. This gene has been shown to exhibit antiproliferative activities and is a tumor suppressor gene candidate. Two transcript variants encoding different isoforms have been found for this gene.This gene encodes a C2H2 zinc finger protein with transactivation and DNA-binding activity. This gene has been shown to exhibit antiproliferative activities and is a tumor suppressor gene candidate. Many transcript variants encoding two different isoforms have been found for this gene. |
Protein Interactions |
UBC; SMAD3; PIAS2; UBE2I; HDAC1; EP300; CREBBP; PML; DAXX; PLAGL1; TP53; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-PLAGL1 (AVARP00029_P050) antibody |
Blocking Peptide |
For anti-PLAGL1 (AVARP00029_P050) antibody is Catalog # AAP30510 (Previous Catalog # AAPP01146) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human PLAGL1 |
Uniprot ID |
Q9UM63 |
Protein Name |
Zinc finger protein PLAGL1 |
Protein Accession # |
NP_006709 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_006718 |
Tested Species Reactivity |
Human |
Gene Symbol |
PLAGL1 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 80%; Rabbit: 100%; Rat: 100% |
Image 1 | Human kidney
| WB Suggested Anti-PLAGL1 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:1562500 Positive Control: Human kidney |
|
Image 2 | Human Lung, Human Brain
| Host: Rabbit Target: PLAGL1 Positive control (+): Human Lung (LU) Negative control (-): Human Brain (BR) Antibody concentration: 1ug/ml |
|
Image 3 |
| 25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment.
|
|