NLRC4 Antibody - C-terminal region (AVARP00019_P050)

Data Sheet
 
Product Number AVARP00019_P050
Product Page www.avivasysbio.com/nlrc4-antibody-c-terminal-region-avarp00019-p050.html
Name NLRC4 Antibody - C-terminal region (AVARP00019_P050)
Protein Size (# AA) 1024 amino acids
Molecular Weight 116kDa
NCBI Gene Id 58484
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name NLR family, CARD domain containing 4
Description
Alias Symbols CLAN, IPAF, AIFEC, CLAN1, CLANA, CLANB, CLANC, CLAND, FCAS4, CARD12, CLR2.1
Peptide Sequence Synthetic peptide located within the following region: QLNLAGNRVSSDGWLAFMGVFENLKQLVFFDFSTKEFLPDPALVRKLSQV
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Clark,H.F., et al., (2003) Genome Res. 13 (10), 2265-2270
Description of Target In C. elegans, Ced4 binds and activates Ced3, an apoptotic initiator caspase, via caspase-associated recruitment domains (CARDs). Human Ced4 homologs include APAF1, NOD1, and NOD2. These proteins have at least 1 N-terminal CARD domain followed by a centrally located nucleotide-binding domain (NBD or NACHT) and a C-terminal regulatory domain, found only in mammals, that contains either WD40 repeats or leucine-rich repeats (LRRs). CARD12 is a member of the Ced4 family and can induce apoptosis.
Protein Interactions UBC; XK; ALB; NLRC4; PSMC5; CASP8; NLRP4; PYCARD; NOD2; BCL10; CASP1; NLRP1; NLRP3; NOD1; NAIP;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-NLRC4 (AVARP00019_P050) antibody
Specificity This antibody will recognize NLRC4 isoform 1 (116kD) and isoform 2 (40kD).
Blocking Peptide For anti-NLRC4 (AVARP00019_P050) antibody is Catalog # AAP30490 (Previous Catalog # AAPP01126)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human NLRC4
Uniprot ID Q9NPP4
Protein Name NLR family CARD domain-containing protein 4
Publications

Inflammasomes are important mediators of cyclophosphamide-induced bladder inflammation. Am J Physiol Renal Physiol. 306, F299-308 (2014). 24285499

The potential repertoire of the innate immune system in the bladder: expression of pattern recognition receptors in the rat bladder and a rat urothelial cell line (MYP3 cells). Int Urol Nephrol. 47, 1953-64 (2015). 26490556

Protein Accession # NP_067032
Purification Affinity Purified
Nucleotide Accession # NM_021209
Tested Species Reactivity Human
Gene Symbol NLRC4
Predicted Species Reactivity Human, Mouse, Rat, Guinea Pig
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Guinea Pig: 80%; Human: 100%; Mouse: 86%; Rat: 80%
Image 1
Human Smooth Muscle
Human Smooth Muscle
Image 2
Human HepG2
WB Suggested Anti-NLRC4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com