| Product Number |
AVARP00017_P050 |
| Product Page |
www.avivasysbio.com/ascl1-antibody-middle-region-avarp00017-p050.html |
| Name |
ASCL1 Antibody - middle region (AVARP00017_P050) |
| Protein Size (# AA) |
236 amino acids |
| Molecular Weight |
25kDa |
| NCBI Gene Id |
429 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Achaete-scute complex homolog 1 (Drosophila) |
| Alias Symbols |
ASH1, HASH1, MASH1, bHLHa46 |
| Peptide Sequence |
Synthetic peptide located within the following region: AGVLSPTISPNYSNDLNSMAGSPVSSYSSDEGSYDPLSPEEQELLDFTNW |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Osada,H., (2008) Cancer Res. 68 (6), 1647-1655 |
| Description of Target |
ASCL1 may play a role at early stages of development of specific neural lineages in most regions of the CNS, and of several lineages in the PNS. ASCL1 is essential for the generation of olfactory and autonomic neurons. ASCL1 activates transcription by binding to the E box (5'-CANNTG-3').This gene encodes a member of the basic helix-loop-helix (BHLH) family of transcription factors. The protein activates transcription by binding to the E box (5'-CANNTG-3'). Dimerization with other BHLH proteins is required for efficient DNA binding. This protein plays a role in the neuronal commitment and differentiation and in the generation of olfactory and autonomic neurons. Mutations in this gene may contribute to the congenital central hypoventilation syndrome (CCHS) phenotype in rare cases. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
| Protein Interactions |
MEF2D; MEF2C; MEF2A; NEUROG2; UBQLN1; EP300; TCF4; BMP2; ASCL1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ASCL1 (AVARP00017_P050) antibody |
| Blocking Peptide |
For anti-ASCL1 (AVARP00017_P050) antibody is Catalog # AAP30431 (Previous Catalog # AAPP01014) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human ASCL1 |
| Uniprot ID |
P50553 |
| Protein Name |
Achaete-scute homolog 1 |
| Sample Type Confirmation |
ASCL1 is strongly supported by BioGPS gene expression data to be expressed in OVCAR3 |
| Protein Accession # |
NP_004307 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_004316 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ASCL1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rat: 100% |
| Image 1 | Human OVCAR3
 | WB Suggested Anti-ASCL1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: OVCAR-3 cell lysateASCL1 is strongly supported by BioGPS gene expression data to be expressed in Human OVCAR3 cells |
|
