| Product Number |
AVARP00011_P050 |
| Product Page |
www.avivasysbio.com/sirpa-antibody-c-terminal-region-avarp00011-p050.html |
| Name |
SIRPA Antibody - C-terminal region (AVARP00011_P050) |
| Protein Size (# AA) |
504 amino acids |
| Molecular Weight |
52kDa |
| NCBI Gene Id |
140885 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Signal-regulatory protein alpha |
| Description |
|
| Alias Symbols |
BIT, MFR, P84, SIRP, MYD-1, SHPS1, CD172A, PTPNS1 |
| Peptide Sequence |
Synthetic peptide located within the following region: QTSPQPASEDTLTYADLDMVHLNRTPKQPAPKPEPSFSEYASVQVPRK |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Kong,X.N., (2007) J. Exp. Med. 204 (11), 2719-2731 |
| Description of Target |
SIRPA is a member of the signal-regulatory-protein (SIRP) family, and also belongs to the immunoglobulin superfamily. SIRP family members are receptor-type transmembrane glycoproteins known to be involved in the negative regulation of receptor tyrosine kinase-coupled signaling processes. This protein can be phosphorylated by tyrosine kinases. The phospho-tyrosine residues of this PTP have been shown to recruit SH2 domain containing tyrosine phosphatases (PTP), and serve as substrates of PTPs. This protein was found to participate in signal transduction mediated by various growth factor receptors. CD47 has been demonstrated to be a ligand for this receptor protein. The protein encoded by this gene is a member of the signal-regulatory-protein (SIRP) family, and also belongs to the immunoglobulin superfamily. SIRP family members are receptor-type transmembrane glycoproteins known to be involved in the negative regulation of receptor tyrosine kinase-coupled signaling processes. This protein can be phosphorylated by tyrosine kinases. The phospho-tyrosine residues of this PTP have been shown to recruit SH2 domain containing tyrosine phosphatases (PTP), and serve as substrates of PTPs. This protein was found to participate in signal transduction mediated by various growth factor receptors. CD47 has been demonstrated to be a ligand for this receptor protein. This gene and its product share very high similarity with several other members of the SIRP family. These related genes are located in close proximity to each other on chromosome 20p13. Multiple alternatively spliced transcript variants have been determined for this gene. |
| Protein Interactions |
CCDC57; KRT40; TRIM2; TRIM27; KRT31; KRT15; UBC; GRB2; Htt; NOL3; IL1RAP; CD47; PTPN6; PTPN11; JAK2; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-SIRPA (AVARP00011_P050) antibody |
| Blocking Peptide |
For anti-SIRPA (AVARP00011_P050) antibody is Catalog # AAP30463 (Previous Catalog # AAPP01047) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human SIRPA |
| Uniprot ID |
B2R6C3 |
| Protein Name |
Tyrosine-protein phosphatase non-receptor type substrate 1 |
| Publications |
Prion pathogenesis is unaltered in the absence of SIRPa-mediated "don't-eat-me" signaling. PLoS One. 12, e0177876 (2017). 28545141 |
| Protein Accession # |
NP_542970 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_080792 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
SIRPA |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Horse, Pig |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 92%; Horse: 84%; Human: 100%; Mouse: 100%; Pig: 90%; Rat: 90% |
| Image 1 | Human MCF-7
 | WB Suggested Anti-SIRPA Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: MCF7 cell lysate |
|
