IGF1R Antibody - middle region (AVARP00004_P050)

Data Sheet
 
Product Number AVARP00004_P050
Product Page www.avivasysbio.com/igf1r-antibody-middle-region-avarp00004-p050.html
Name IGF1R Antibody - middle region (AVARP00004_P050)
Protein Size (# AA) 1367 amino acids
Molecular Weight 71kDa
NCBI Gene Id 3480
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Insulin-like growth factor 1 receptor
Description
Alias Symbols IGFR, CD221, IGFIR, JTK13
Peptide Sequence Synthetic peptide located within the following region: DRHSGHKAENGPGPGVLVLRASFDERQPYAHMNGGRKNERALPLPQSSTC
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Urano,T., (2008) Spine 33 (11), 1256-1261
Description of Target This receptor binds insulin-like growth factor with a high affinity. It has tyrosine kinase activity. The insulin-like growth factor I receptor plays a critical role in transformation events. Cleavage of the precursor generates alpha and beta subunits. It is highly overexpressed in most malignant tissues where it functions as an anti-apoptotic agent by enhancing cell survival.This receptor binds insulin-like growth factor with a high affinity. It has tyrosine kinase activity. The insulin-like growth factor I receptor plays a critical role in transformation events. Cleavage of the precursor generates alpha and beta subunits. It is highly overexpressed in most malignant tissues where it functions as an anti-apoptotic agent by enhancing cell survival. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-140 DR007209.1 566-705 141-3559 X04434.1 136-3554 3560-4540 BC113610.1 3542-4522 4541-4921 DA486252.1 187-567 4922-5392 BX093045.1 248-718 5393-5768 CN414655.1 317-692 5769-6158 BM264223.1 185-574 6159-6580 BQ185364.1 187-608 6581-11242 AC069029.9 21278-25939 c
Protein Interactions KCNIP3; UBC; ESR1; PHB2; SHC1; FBXO6; SH2B1; Slc23a3; RPL11; HSP90AA1; GRB14; FFAR2; ARRB2; AMY2A; APP; RUVBL1; GNB2L1; ARRB1; YWHAG; TP53; NEDD4; MDM2; GRB10; SUMO1; CAMP; ERBB2; EGFR; KRT27; DOK5; DOK4; WISP2; EHD1; ARHGEF12; PIK3R3; VAV3; PRKD1; SOCS2;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-IGF1R (AVARP00004_P050) antibody
Specificity Directed to the beta chain of IGF1R
Blocking Peptide For anti-IGF1R (AVARP00004_P050) antibody is Catalog # AAP30448 (Previous Catalog # AAPP01032)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human IGF1R
Uniprot ID P08069
Protein Name Insulin-like growth factor 1 receptor
Publications

Kubota, T. et al. Insulin-like growth factor-1 receptor in mature osteoblasts is required for periosteal bone formation induced by reloading. Acta Astronaut. 92, 73-78 (2013). 23976802

Roles of progesterone receptor membrane component 1 and membrane progestin receptor alpha in regulation of zebrafish oocyte maturation. Gen Comp Endocrinol. 263, 51-61 (2018). 29649418

Protein Accession # NP_000866
Purification Affinity Purified
Nucleotide Accession # NM_000875
Tested Species Reactivity Human, Mouse
Gene Symbol IGF1R
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Horse, Pig, Sheep, Zebrafish
Application IHC, IF, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 92%; Pig: 100%; Rat: 92%; Sheep: 100%; Zebrafish: 100%
Image 1
Human HCT116 Whole Cell
Host: Rabbit
Target Name: IGF1R
Sample Tissue: Human HCT116 Whole Cell
Antibody Dilution: 1ug/ml
Image 2
mouse skeletal muscle
Immunofluorescent IGF1R detection in mouse skeletal muscle (red fluorescence). Nuclei were stained with DAPI (blue fluorescence).
Working dilution: 2-10 ug/ml
Image 3
Human Jurkat
WB Suggested Anti-IGF1R Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com