| Product Number |
ARP97917_P050 |
| Product Page |
www.avivasysbio.com/cyp2b6-antibody-middle-region-arp97917-p050.html |
| Name |
CYP2B6 Antibody - middle region (ARP97917_P050) |
| Protein Size (# AA) |
491 amino acids |
| Molecular Weight |
56 kDa |
| NCBI Gene Id |
1555 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
cytochrome P450 family 2 subfamily B member 6 |
| Alias Symbols |
CPB6, EFVM, IIB1, P450, CYP2B, CYP2B7, CYP2B7P, CYPIIB6 |
| Peptide Sequence |
Synthetic peptide located within the following region: DLIDTYLLHMEKEKSNAHSEFSHQNLNLNTLSLFFAGTETTSTTLRYGFL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
This gene, CYP2B6, encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and its expression is induced by phenobarbital. The enzyme is known to metabolize some xenobiotics, such as the anti-cancer drugs cyclophosphamide and ifosphamide. Transcript variants for this gene have been described; however, it has not been resolved whether these transcripts are in fact produced by this gene or by a closely related pseudogene, CYP2B7. Both the gene and the pseudogene are located in the middle of a CYP2A pseudogene found in a large cluster of cytochrome P450 genes from the CYP2A, CYP2B and CYP2F subfamilies on chromosome 19q. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-CYP2B6 (ARP97917_P050) antibody |
| Blocking Peptide |
For anti-CYP2B6 (ARP97917_P050) antibody is Catalog # AAP97917 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human CYP2B6 |
| Uniprot ID |
P20813 |
| Protein Name |
cytochrome P450 2B6 |
| Protein Accession # |
NP_000758.1 |
| Purification |
Affinity purified |
| Nucleotide Accession # |
NM_000767.4 |
| Gene Symbol |
CYP2B6 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Image 1 | Human 786-0 Whole Cell
 | Host: Rabbit
Target Name: CYP2B6
Sample Tissue: Human 786-0 Whole Cell lysates
Antibody Dilution: 1ug/ml |
|
|
