| Product Number |
ARP97795_P050 |
| Product Page |
www.avivasysbio.com/eps15-antibody-c-terminal-region-arp97795-p050.html |
| Name |
EPS15 Antibody - C-terminal region (ARP97795_P050) |
| Protein Size (# AA) |
582 amino acids |
| Molecular Weight |
64 kDa |
| NCBI Gene Id |
2060 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
epidermal growth factor receptor pathway substrate 15 |
| Alias Symbols |
AF1P, AF-1P, MLLT5 |
| Peptide Sequence |
Synthetic peptide located within the following region: KLNDPFQPFPGNDSPKEKDPEIFCDPFTSATTTTNKEADPSNFANFSAYP |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
This gene encodes a protein that is part of the EGFR pathway. The protein is present at clatherin-coated pits and is involved in receptor-mediated endocytosis of EGF. Notably, this gene is rearranged with the HRX/ALL/MLL gene in acute myelogeneous leukemias. Alternative splicing results in multiple transcript variants encoding distinct isoforms. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-EPS15 (ARP97795_P050) antibody |
| Blocking Peptide |
For anti-EPS15 (ARP97795_P050) antibody is Catalog # AAP97795 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human EPS15 |
| Uniprot ID |
P42566-2 |
| Protein Name |
epidermal growth factor receptor substrate 15 |
| Protein Accession # |
NP_001153441.1 |
| Purification |
Affinity purified |
| Nucleotide Accession # |
NM_001159969.1 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
EPS15 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Image 1 | Human K562 Whole Cell
 | Host: Rabbit
Target Name: EPS15
Sample Tissue: Human K562 Whole Cell lysates
Antibody Dilution: 1ug/ml |
|
|
