PLA2G6 Antibody - middle region (ARP97771_P050)

• Product Number: ARP97771_P050
• Name: PLA2G6 Antibody - middle region (ARP97771_P050)
• Protein Size (# AA): 806 amino acids
• Molecular Weight: 88 kDa
• NCBI Gene Id: 8398
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: phospholipase A2 group VI
• Alias Symbols: GVI, PLA2, INAD1, NBIA2, iPLA2, NBIA2A, NBIA2B, PARK14, PNPLA9, CaI-PLA2, IPLA2-VIA, iPLA2beta
• Peptide Sequence: Synthetic peptide located within the following region: LTGTLSDRQPAELHLFRNYDAPETVREPRFNQNVNLRPPAQPSDQLVWRA
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: The protein encoded by this gene is an A2 phospholipase, a class of enzyme that catalyzes the release of fatty acids from phospholipids. The encoded protein may play a role in phospholipid remodelling, arachidonic acid release, leukotriene and prostaglandin synthesis, fas-mediated apoptosis, and transmembrane ion flux in glucose-stimulated B-cells. Several transcript variants encoding multiple isoforms have been described, but the full-length nature of only three of them have been determined to date.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-PLA2G6 (ARP97771_P050) antibody is Catalog # AAP97771
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PLA2G6
• Uniprot ID: O60733
• Protein Name: 85/88 kDa calcium-independent phospholipase A2
• Protein Accession #: NP_001004426.1
• Purification: Affinity purified
• Nucleotide Accession #: NM_001004426.1
• Tested Species Reactivity: Human
• Gene Symbol: PLA2G6
• Predicted Species Reactivity: Human
• Application: WB
• Image 1: Human Hela Whole Cell
  
  Host: Rabbit
  Target Name: PLA2G6
  Sample Tissue: Human Hela Whole Cell lysates
  Antibody Dilution: 1ug/ml