| Product Number |
ARP97524_P050 |
| Product Page |
www.avivasysbio.com/elavl1-antibody-middle-region-arp97524-p050.html |
| Name |
ELAVL1 Antibody - middle region (ARP97524_P050) |
| Protein Size (# AA) |
326 amino acids |
| Molecular Weight |
35 kDa |
| NCBI Gene Id |
1994 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
ELAV like RNA binding protein 1 |
| Alias Symbols |
HUR, Hua, MelG, ELAV1 |
| Peptide Sequence |
Synthetic peptide located within the following region: DKRSEAEEAITSFNGHKPPGSSEPITVKFAANPNQNKNVALLSQLYHSPA |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The protein encoded by this gene is a member of the ELAVL family of RNA-binding proteins that contain several RNA recognition motifs, and selectively bind AU-rich elements (AREs) found in the 3' untranslated regions of mRNAs. AREs signal degradation of mRNAs as a means to regulate gene expression, thus by binding AREs, the ELAVL family of proteins play a role in stabilizing ARE-containing mRNAs. This gene has been implicated in a variety of biological processes and has been linked to a number of diseases, including cancer. It is highly expressed in many cancers, and could be potentially useful in cancer diagnosis, prognosis, and therapy. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ELAVL1 (ARP97524_P050) antibody |
| Blocking Peptide |
For anti-ELAVL1 (ARP97524_P050) antibody is Catalog # AAP97524 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human ELAVL1 |
| Uniprot ID |
Q15717 |
| Protein Name |
ELAV-like protein 1 |
| Protein Accession # |
NP_001410.2 |
| Purification |
Affinity purified |
| Nucleotide Accession # |
NM_001419.2 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ELAVL1 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Image 1 | Human 293T Whole Cell
 | Host: Rabbit
Target Name: ELAVL1
Sample Tissue: Human 293T Whole Cell lysates
Antibody Dilution: 1ug/ml |
|
|
