Product Number |
ARP97316_P050 |
Product Page |
www.avivasysbio.com/smad3-antibody-n-terminal-region-arp97316-p050.html |
Name |
SMAD3 Antibody - N-terminal region (ARP97316_P050) |
Protein Size (# AA) |
425 amino acids |
Molecular Weight |
46 kDa |
NCBI Gene Id |
4088 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
SMAD family member 3 |
Alias Symbols |
LDS3, LDS1C, MADH3, JV15-2, HSPC193, HsT17436 |
Peptide Sequence |
Synthetic peptide located within the following region: SILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELE |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
The protein encoded by this gene belongs to the SMAD, a family of proteins similar to the gene products of the Drosophila gene 'mothers against decapentaplegic' (Mad) and the C. elegans gene Sma. SMAD proteins are signal transducers and transcriptional modulators that mediate multiple signaling pathways. This protein functions as a transcriptional modulator activated by transforming growth factor-beta and is thought to play a role in the regulation of carcinogenesis. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-SMAD3 (ARP97316_P050) antibody |
Blocking Peptide |
For anti-SMAD3 (ARP97316_P050) antibody is Catalog # AAP97316 |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human SMAD3 |
Uniprot ID |
P84022 |
Protein Name |
Mothers against decapentaplegic homolog 3 |
Protein Accession # |
NP_001138574.1 |
Purification |
Affinity purified |
Nucleotide Accession # |
NM_001145102.1 |
Tested Species Reactivity |
Human |
Gene Symbol |
SMAD3 |
Predicted Species Reactivity |
Human |
Application |
WB |
Image 1 | Human Jurkat Whole Cell
| Host: Rabbit Target Name: SMAD3 Sample Tissue: Human Jurkat Whole Cell lysates Antibody Dilution: 1ug/ml |
|
|