SMAD3 Antibody - N-terminal region (ARP97316_P050)

Data Sheet
 
Product Number ARP97316_P050
Product Page www.avivasysbio.com/smad3-antibody-n-terminal-region-arp97316-p050.html
Name SMAD3 Antibody - N-terminal region (ARP97316_P050)
Protein Size (# AA) 425 amino acids
Molecular Weight 46 kDa
NCBI Gene Id 4088
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name SMAD family member 3
Alias Symbols LDS3, LDS1C, MADH3, JV15-2, HSPC193, HsT17436
Peptide Sequence Synthetic peptide located within the following region: SILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELE
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target The protein encoded by this gene belongs to the SMAD, a family of proteins similar to the gene products of the Drosophila gene 'mothers against decapentaplegic' (Mad) and the C. elegans gene Sma. SMAD proteins are signal transducers and transcriptional modulators that mediate multiple signaling pathways. This protein functions as a transcriptional modulator activated by transforming growth factor-beta and is thought to play a role in the regulation of carcinogenesis.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-SMAD3 (ARP97316_P050) antibody
Blocking Peptide For anti-SMAD3 (ARP97316_P050) antibody is Catalog # AAP97316
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human SMAD3
Uniprot ID P84022
Protein Name Mothers against decapentaplegic homolog 3
Protein Accession # NP_001138574.1
Purification Affinity purified
Nucleotide Accession # NM_001145102.1
Tested Species Reactivity Human
Gene Symbol SMAD3
Predicted Species Reactivity Human
Application WB
Image 1
Human Jurkat Whole Cell
Host: Rabbit
Target Name: SMAD3
Sample Tissue: Human Jurkat Whole Cell lysates
Antibody Dilution: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com