| Product Number |
ARP97266_P050 |
| Product Page |
www.avivasysbio.com/becn1-antibody-n-terminal-region-arp97266-p050.html |
| Name |
BECN1 Antibody - N-terminal region (ARP97266_P050) |
| Protein Size (# AA) |
450 amino acids |
| Molecular Weight |
49 kDa |
| NCBI Gene Id |
8678 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
beclin 1 |
| Alias Symbols |
ATG6, VPS30, beclin1 |
| Peptide Sequence |
Synthetic peptide located within the following region: LTTAQAKPGETQEEETNSGEEPFIETPRQDGVSRRFIPPARMMSTESANS |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
This gene encodes a protein that regulates autophagy, a catabolic process of degradation induced by starvation. The encoded protein is a component of the phosphatidylinositol-3-kinase (PI3K) complex which mediates vesicle-trafficking processes. This protein is thought to play a role in multiple cellular processes, including tumorigenesis, neurodegeneration and apoptosis. Alternative splicing results in multiple transcript variants. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-PDIA2 (ARP97266_P050) antibody |
| Blocking Peptide |
For anti-BECN1 (ARP97266_P050) antibody is Catalog # AAP97266 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human BECN1 |
| Uniprot ID |
Q14457 |
| Protein Name |
Beclin-1 |
| Protein Accession # |
NP_001300927.1 |
| Purification |
Affinity purified |
| Nucleotide Accession # |
NM_001313998.1 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
BECN1 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Image 1 | Human Hela Whole Cell
 | Host: Rabbit
Target Name: BECN1
Sample Tissue: Human Hela Whole Cell lysates
Antibody Dilution: 1ug/ml |
|
|
