CTNNB1 Antibody - C-terminal region (ARP97257_P050)

• Product Number: ARP97257_P050
• Name: CTNNB1 Antibody - C-terminal region (ARP97257_P050)
• Protein Size (# AA): 781 amino acids
• Molecular Weight: 86 kDa
• NCBI Gene Id: 1499
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: catenin beta 1
• Alias Symbols: EVR7, CTNNB, MRD19, NEDSDV, armadillo
• Peptide Sequence: Synthetic peptide located within the following region: ETADLGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDPMMEHEMGG
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: The protein encoded by this gene is part of a complex of proteins that constitute adherens junctions (AJs). AJs are necessary for the creation and maintenance of epithelial cell layers by regulating cell growth and adhesion between cells. The encoded protein also anchors the actin cytoskeleton and may be responsible for transmitting the contact inhibition signal that causes cells to stop dividing once the epithelial sheet is complete. Finally, this protein binds to the product of the APC gene, which is mutated in adenomatous polyposis of the colon. Mutations in this gene are a cause of colorectal cancer (CRC), pilomatrixoma (PTR), medulloblastoma (MDB), and ovarian cancer. Alternative splicing results in multiple transcript variants.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation: Relative Expression (Western Blot)
  
• Blocking Peptide: For anti-CTNNB1 (ARP97257_P050) antibody is Catalog # AAP97257
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CTNNB1
• Uniprot ID: P35222
• Protein Name: Catenin beta-1
• Protein Accession #: NP_001091679.1
• Purification: Affinity purified
• Nucleotide Accession #: NM_001098209.1
• Tested Species Reactivity: Human
• Gene Symbol: CTNNB1
• Predicted Species Reactivity: Human
• Application: WB
• Image 1: Human THP-1 Whole Cell
  
  Host: Rabbit
  Target Name: CTNNB1
  Sample Tissue: Human THP-1 Whole Cell lysates
  Antibody Dilution: 1ug/ml
• Image 2: Western Blot
  
  25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. Canonical 86 kDa isoform is identified, higher molecular weight bands may reflect modified forms of the protein.