Product Number |
ARP97247_P050 |
Product Page |
www.avivasysbio.com/pc-antibody-middle-region-arp97247-p050.html |
Name |
PC Antibody - middle region (ARP97247_P050) |
Protein Size (# AA) |
1178 amino acids |
Molecular Weight |
129 kDa |
NCBI Gene Id |
25104 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
pyruvate carboxylase |
Alias Symbols |
Pcx |
Peptide Sequence |
Synthetic peptide located within the following region: EAAISYTGDVADPSRTKYSLEYYMGLAEELVRAGTHILCIKDMAGLLKPA |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
biotin-containing enzyme that catalyses the carboxylation of pyruvate to form oxaloacetate. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-PC (ARP97247_P050) antibody |
Blocking Peptide |
For anti-PC (ARP97247_P050) antibody is Catalog # AAP97247 |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of rat PC |
Uniprot ID |
P52873 |
Protein Name |
Pyruvate carboxylase, mitochondrial |
Protein Accession # |
NP_036876 |
Purification |
Affinity purified |
Nucleotide Accession # |
NM_012744.2 |
Tested Species Reactivity |
Rat |
Gene Symbol |
PC |
Predicted Species Reactivity |
Rat |
Application |
WB |
Image 1 | Rat Liver
| Host: Rabbit Target Name: PC Sample Tissue: Rat Liver lysates Antibody Dilution: 1ug/ml |
|
|