PC Antibody - middle region (ARP97247_P050)

Data Sheet
 
Product Number ARP97247_P050
Product Page www.avivasysbio.com/pc-antibody-middle-region-arp97247-p050.html
Name PC Antibody - middle region (ARP97247_P050)
Protein Size (# AA) 1178 amino acids
Molecular Weight 129 kDa
NCBI Gene Id 25104
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name pyruvate carboxylase
Alias Symbols Pcx
Peptide Sequence Synthetic peptide located within the following region: EAAISYTGDVADPSRTKYSLEYYMGLAEELVRAGTHILCIKDMAGLLKPA
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target biotin-containing enzyme that catalyses the carboxylation of pyruvate to form oxaloacetate.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-PC (ARP97247_P050) antibody
Blocking Peptide For anti-PC (ARP97247_P050) antibody is Catalog # AAP97247
Immunogen The immunogen is a synthetic peptide directed towards the middle region of rat PC
Uniprot ID P52873
Protein Name Pyruvate carboxylase, mitochondrial
Protein Accession # NP_036876
Purification Affinity purified
Nucleotide Accession # NM_012744.2
Tested Species Reactivity Rat
Gene Symbol PC
Predicted Species Reactivity Rat
Application WB
Image 1
Rat Liver
Host: Rabbit
Target Name: PC
Sample Tissue: Rat Liver lysates
Antibody Dilution: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com