ATP1A2 Antibody - N-terminal region (ARP96897_P050)

Data Sheet
 
Product Number ARP96897_P050
Product Page www.avivasysbio.com/atp1a2-antibody-n-terminal-region-arp96897-p050.html
Name ATP1A2 Antibody - N-terminal region (ARP96897_P050)
Protein Size (# AA) 1020 amino acids
Molecular Weight 112 kDa
NCBI Gene Id 477
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name ATPase, Na+/K+ transporting, alpha 2 polypeptide
Alias Symbols FHM2, MHP2
Peptide Sequence Synthetic peptide located within the following region: TTPEWVKFCRQLFGGFSILLWIGAILCFLAYGIQAAMEDEPSNDNLYLGV
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target The protein encoded by this gene belongs to the family of P-type cation transport ATPases, and to the subfamily of Na+/K+ -ATPases. Na+/K+ -ATPase is an integral membrane protein responsible for establishing and maintaining the electrochemical gradients of Na and K ions across the plasma membrane. These gradients are essential for osmoregulation, for sodium-coupled transport of a variety of organic and inorganic molecules, and for electrical excitability of nerve and muscle. This enzyme is composed of two subunits, a large catalytic subunit (alpha) and a smaller glycoprotein subunit (beta). The catalytic subunit of Na+/K+ -ATPase is encoded by multiple genes. This gene encodes an alpha 2 subunit. Mutations in this gene result in familial basilar or hemiplegic migraines, and in a rare syndrome known as alternating hemiplegia of childhood.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ATP1A2 (ARP96897_P050) antibody
Blocking Peptide For anti-ATP1A2 (ARP96897_P050) antibody is Catalog # AAP96897
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ATP1A2
Uniprot ID P50993
Protein Name sodium/potassium-transporting ATPase subunit alpha-2
Protein Accession # NP_000693.1
Purification Affinity purified
Nucleotide Accession # NM_000702.3
Tested Species Reactivity Human
Gene Symbol ATP1A2
Predicted Species Reactivity Human
Application WB
Image 1
Human Du145 Whole Cell
Host: Rabbit
Target Name: ATP1A2
Sample Tissue: Human Du145 Whole Cell lysates
Antibody Dilution: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com