Product Number |
ARP96897_P050 |
Product Page |
www.avivasysbio.com/atp1a2-antibody-n-terminal-region-arp96897-p050.html |
Name |
ATP1A2 Antibody - N-terminal region (ARP96897_P050) |
Protein Size (# AA) |
1020 amino acids |
Molecular Weight |
112 kDa |
NCBI Gene Id |
477 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
ATPase, Na+/K+ transporting, alpha 2 polypeptide |
Alias Symbols |
FHM2, MHP2 |
Peptide Sequence |
Synthetic peptide located within the following region: TTPEWVKFCRQLFGGFSILLWIGAILCFLAYGIQAAMEDEPSNDNLYLGV |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
The protein encoded by this gene belongs to the family of P-type cation transport ATPases, and to the subfamily of Na+/K+ -ATPases. Na+/K+ -ATPase is an integral membrane protein responsible for establishing and maintaining the electrochemical gradients of Na and K ions across the plasma membrane. These gradients are essential for osmoregulation, for sodium-coupled transport of a variety of organic and inorganic molecules, and for electrical excitability of nerve and muscle. This enzyme is composed of two subunits, a large catalytic subunit (alpha) and a smaller glycoprotein subunit (beta). The catalytic subunit of Na+/K+ -ATPase is encoded by multiple genes. This gene encodes an alpha 2 subunit. Mutations in this gene result in familial basilar or hemiplegic migraines, and in a rare syndrome known as alternating hemiplegia of childhood. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-ATP1A2 (ARP96897_P050) antibody |
Blocking Peptide |
For anti-ATP1A2 (ARP96897_P050) antibody is Catalog # AAP96897 |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ATP1A2 |
Uniprot ID |
P50993 |
Protein Name |
sodium/potassium-transporting ATPase subunit alpha-2 |
Protein Accession # |
NP_000693.1 |
Purification |
Affinity purified |
Nucleotide Accession # |
NM_000702.3 |
Tested Species Reactivity |
Human |
Gene Symbol |
ATP1A2 |
Predicted Species Reactivity |
Human |
Application |
WB |
Image 1 | Human Du145 Whole Cell
| Host: Rabbit Target Name: ATP1A2 Sample Tissue: Human Du145 Whole Cell lysates Antibody Dilution: 1ug/ml |
|
|