| Product Number |
ARP96867_P050 |
| Product Page |
www.avivasysbio.com/gtpbp3-antibody-middle-region-arp96867-p050.html |
| Name |
GTPBP3 Antibody - middle region (ARP96867_P050) |
| Protein Size (# AA) |
471 amino acids |
| Molecular Weight |
51 kDa |
| NCBI Gene Id |
84705 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
MSS1, MTGP1, THDF1, GTPBG3, COXPD23 |
| Alias Symbols |
MSS1, MTGP1, THDF1, GTPBG3, COXPD23 |
| Peptide Sequence |
Synthetic peptide located within the following region: LREGVGPVEQEGVRRARERLEQADLILAMLDASDLASPSSCNFLATVVAS |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
This locus encodes a GTP-binding protein. The encoded protein is localized to the mitochondria and may play a role in mitochondrial tRNA modification. Polymorphisms at this locus may be associated with severity of aminoglycoside-induced deafness, a disease associated with a mutation in the 12S rRNA. Alternatively spliced transcript variants encoding different isoforms have been described. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-GTPBP3 (ARP96867_P050) antibody |
| Blocking Peptide |
For anti-GTPBP3 (ARP96867_P050) antibody is Catalog # AAP96867 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human GTPBP3 |
| Uniprot ID |
Q969Y2-3 |
| Protein Name |
This locus encodes a GTP-binding protein. The encoded protein is localized to the mitochondria and may play a role in mitochondrial tRNA modification. Polymorphisms at this locus may be associated with severity of aminoglycoside-induced deafness, a disease associated with a mutation in the 12S rRNA. Alternatively spliced transcript variants encoding different isoforms have been described. |
| Protein Accession # |
NP_001122327.1 |
| Purification |
Affinity purified |
| Nucleotide Accession # |
NM_001128855.2 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
GTPBP3 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Image 1 | Human PC-3 Whole Cell
 | Host: Rabbit
Target Name: GTPBP3
Sample Tissue: Human PC-3 Whole Cell lysates
Antibody Dilution: 1ug/ml |
|
|
