Product Number |
ARP96867_P050 |
Product Page |
www.avivasysbio.com/gtpbp3-antibody-middle-region-arp96867-p050.html |
Name |
GTPBP3 Antibody - middle region (ARP96867_P050) |
Protein Size (# AA) |
471 amino acids |
Molecular Weight |
51 kDa |
NCBI Gene Id |
84705 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
MSS1, MTGP1, THDF1, GTPBG3, COXPD23 |
Alias Symbols |
MSS1, MTGP1, THDF1, GTPBG3, COXPD23 |
Peptide Sequence |
Synthetic peptide located within the following region: LREGVGPVEQEGVRRARERLEQADLILAMLDASDLASPSSCNFLATVVAS |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
This locus encodes a GTP-binding protein. The encoded protein is localized to the mitochondria and may play a role in mitochondrial tRNA modification. Polymorphisms at this locus may be associated with severity of aminoglycoside-induced deafness, a disease associated with a mutation in the 12S rRNA. Alternatively spliced transcript variants encoding different isoforms have been described. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-GTPBP3 (ARP96867_P050) antibody |
Blocking Peptide |
For anti-GTPBP3 (ARP96867_P050) antibody is Catalog # AAP96867 |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human GTPBP3 |
Uniprot ID |
Q969Y2-3 |
Protein Name |
This locus encodes a GTP-binding protein. The encoded protein is localized to the mitochondria and may play a role in mitochondrial tRNA modification. Polymorphisms at this locus may be associated with severity of aminoglycoside-induced deafness, a disease associated with a mutation in the 12S rRNA. Alternatively spliced transcript variants encoding different isoforms have been described. |
Protein Accession # |
NP_001122327.1 |
Purification |
Affinity purified |
Nucleotide Accession # |
NM_001128855.2 |
Tested Species Reactivity |
Human |
Gene Symbol |
GTPBP3 |
Predicted Species Reactivity |
Human |
Application |
WB |
Image 1 | Human PC-3 Whole Cell
| Host: Rabbit Target Name: GTPBP3 Sample Tissue: Human PC-3 Whole Cell lysates Antibody Dilution: 1ug/ml |
|
|