OLFR484 Antibody - C-terminal region (ARP96625_P050)

Data Sheet
 
Product Number ARP96625_P050
Product Page www.avivasysbio.com/olfr484-antibody-c-terminal-region-arp96625-p050.html
Name OLFR484 Antibody - C-terminal region (ARP96625_P050)
Protein Size (# AA) 321 amino acids
Molecular Weight 36 kDa
NCBI Gene Id 258492
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name olfactory receptor 484
Alias Symbols MOR204-, MOR204-16
Peptide Sequence Synthetic peptide located within the following region: KSRYSTDQNKVVSVFYMVVIPMLNPLIYSLRNNEIKGALRRHLGKKIFSQ
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-OLFR484 (ARP96625_P050) antibody
Blocking Peptide For anti-OLFR484 (ARP96625_P050) antibody is Catalog # ARP96625_P050
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of mouse OLFR484
Uniprot ID Q8VFD3
Protein Name Olfactory receptor 484
Protein Accession # NP_666710.1
Purification Affinity purified
Nucleotide Accession # NM_146499.1
Tested Species Reactivity Mouse
Gene Symbol OLFR484
Predicted Species Reactivity Mouse
Application WB
Image 1
Mouse Heart
Host: Rabbit
Target Name: OLFR484
Sample Tissue: Mouse Heart lysates
Antibody Dilution: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com