Product Number |
ARP96584_P050 |
Product Page |
www.avivasysbio.com/olfr1020-antibody-n-terminal-region-arp96584-p050.html |
Name |
OLFR1020 Antibody - N-terminal region (ARP96584_P050) |
Protein Size (# AA) |
317 amino acids |
Molecular Weight |
35 kDa |
NCBI Gene Id |
258573 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
olfactory receptor 1020 |
Alias Symbols |
MOR201, MOR201-2 |
Peptide Sequence |
Synthetic peptide located within the following region: MVRSGKGIQNKNATEVTEFILLGLSDNPDLQGVLFALFLIIYTMTLVGNL |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-OLFR1020 (ARP96584_P050) antibody |
Blocking Peptide |
For anti-OLFR1020 (ARP96584_P050) antibody is Catalog # AAP96584 |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of mouse OLFR1020 |
Uniprot ID |
Q8VFK7 |
Protein Name |
Olfactory receptor 1020 |
Protein Accession # |
NP_666791.1 |
Purification |
Affinity purified |
Nucleotide Accession # |
NM_146580.2 |
Tested Species Reactivity |
Mouse |
Gene Symbol |
OLFR1020 |
Predicted Species Reactivity |
Mouse |
Application |
WB |
Image 1 | Mouse Liver
| Host: Rabbit Target Name: OLFR1020 Sample Tissue: Mouse Liver lysates Antibody Dilution: 1ug/ml |
|
|