OLFR488 Antibody - C-terminal region (ARP96519_P050)

Data Sheet
 
Product Number ARP96519_P050
Product Page www.avivasysbio.com/olfr488-antibody-c-terminal-region-arp96519-p050.html
Product Name OLFR488 Antibody - C-terminal region (ARP96519_P050)
Size 100 ul
Gene Symbol OLFR488
Alias Symbols MOR204-15
Protein Size (# AA) 314 amino acids
Molecular Weight 35 kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 258727
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name olfactory receptor 488
Peptide Sequence Synthetic peptide located within the following region: IYVMPKSTYSRDQNKVVSLFYMVVIPMLNPLIYSLRNNEIKGALKKQFYR
Description of Target Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Tips Information

See our General FAQ page.

Datasheets/Manuals Printable datasheet for anti-OLFR488 (ARP96519_P050) antibody
Protocol
The following related protocols are available on www.avivasysbio.com
Lead Time Domestic: within 24 hours delivery International: 3-5 business days
Blocking Peptide For anti-OLFR488 (ARP96519_P050) antibody is Catalog # AAP96519
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of mouse OLFR488
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express OLFR488.
Swissprot Id Q8VG02
Protein Name Olfactory receptor 488
Protein Accession # NP_666943.1
Purification Affinity purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express OLFR488.
Nucleotide Accession # NM_146732.1
Tested Species Reactivity Mouse
Predicted Species Reactivity Mouse
Application WB
Image 1
Mouse Heart
Host: Rabbit
Target Name: OLFR488
Sample Tissue: Mouse Heart lysates
Antibody Dilution: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
7700 Ronson Road, Ste 100, San Diego, CA 92111 USA | Tel: (858)552-6979 | info@avivasysbio.com