OLFR508 Antibody - C-terminal region (ARP96517_P050)

Data Sheet
 
Product Number ARP96517_P050
Product Page www.avivasysbio.com/olfr508-antibody-c-terminal-region-arp96517-p050.html
Alias Symbols MOR204-6
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name olfactory receptor 508
NCBI Gene Id 258769
Gene Symbol OLFR508
Host Rabbit
Molecular Weight 34 kDa
Product Name OLFR508 Antibody - C-terminal region (ARP96517_P050)
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Protein Size (# AA) 310 amino acids
Size 100 ul
Peptide Sequence Synthetic peptide located within the following region: MPKSSYSTDQNKVVSVFYTVVIPMLNPIIYSLRNKDVKEAMKKLMANTHH
Description of Target Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Tips Information

See our General FAQ page.

Datasheets/Manuals Printable datasheet for anti-OLFR508 (ARP96517_P050) antibody
Protocol
The following related protocols are available on www.avivasysbio.com
Lead Time Domestic: within 24 hours delivery International: 3-5 business days
Blocking Peptide For anti-OLFR508 (ARP96517_P050) antibody is Catalog # AAP96517
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of mouse OLFR508
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express OLFR508.
Swissprot Id Q8VG42
Protein Name Olfactory receptor 508
Protein Accession # NP_666984.1
Purification Affinity purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express OLFR508.
Nucleotide Accession # NM_146773.1
Tested Species Reactivity Mouse
Predicted Species Reactivity Mouse
Application WB
Image 1
Mouse Spleen
Host: Rabbit
Target Name: OLFR508
Sample Tissue: Mouse Spleen lysates
Antibody Dilution: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
7700 Ronson Road, Ste 100, San Diego, CA 92111 USA | Tel: (858)552-6979 | info@avivasysbio.com