| Product Number |
ARP96156_P050 |
| Product Page |
www.avivasysbio.com/9530077c05rik-antibody-middle-region-arp96156-p050.html |
| Name |
Matcap2 Antibody - middle region (ARP96156_P050) |
| Protein Size (# AA) |
519 amino acids |
| Molecular Weight |
57 kDa |
| NCBI Gene Id |
68283 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
RIKEN cDNA 9530077C05 gene |
| Alias Symbols |
mKIAA0895, 1110003N12Rik, Matcap2 |
| Peptide Sequence |
Synthetic peptide located within the following region: GINNLQQPWNSWIGRKKHELKPNNPTEEGLASIHSVLFRKDPFLWRAALL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-9530077C05RIK (ARP96156_P050) antibody |
| Blocking Peptide |
For anti-9530077C05RIK (ARP96156_P050) antibody is Catalog # AAP96156 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of mouse KIAA0895 |
| Uniprot ID |
Q7TQE7 |
| Protein Name |
Putative tyrosine carboxypeptidase MATCAP2
|
| Protein Accession # |
NP_081015.1 |
| Purification |
Affinity purified |
| Nucleotide Accession # |
NM_026739.1 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
Matcap2 |
| Predicted Species Reactivity |
Mouse |
| Application |
WB |
| Image 1 | Mouse Spleen
 | Host: Rabbit
Target Name: KIAA0895
Sample Tissue: Mouse Spleen lysates
Antibody Dilution: 1ug/ml |
|
|
