SNRNP48 Antibody - C-terminal region (ARP95785_P050)

Data Sheet
 
Product Number ARP95785_P050
Product Page www.avivasysbio.com/snrnp48-antibody-c-terminal-region-arp95785-p050.html
Name SNRNP48 Antibody - C-terminal region (ARP95785_P050)
Protein Size (# AA) 337 amino acids
Molecular Weight 37 kDa
NCBI Gene Id 67797
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name small nuclear ribonucleoprotein 48 (U11/U12)
Alias Symbols C6orf151, 1110050F08Rik, 6530403A03Rik
Peptide Sequence Synthetic peptide located within the following region: YLDVESSRHRRARSRSPHKRKRNKDKSSESRRRKERDGERHHSHKRRKQK
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target Likely involved in U12-type 5' splice site recognition.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-SNRNP48 (ARP95785_P050) antibody
Blocking Peptide For anti-SNRNP48 (ARP95785_P050) antibody is Catalog # AAP95785
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of mouse SNRNP48
Uniprot ID Q9D361
Protein Name U11/U12 small nuclear ribonucleoprotein 48 kDa protein
Protein Accession # NP_080658.2
Purification Affinity purified
Nucleotide Accession # NM_026382.2
Tested Species Reactivity Mouse
Gene Symbol SNRNP48
Predicted Species Reactivity Mouse
Application WB
Image 1
Mouse Liver
Host: Rabbit
Target Name: SNRNP48
Sample Tissue: Mouse Liver lysates
Antibody Dilution: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com