Product Number |
ARP95785_P050 |
Product Page |
www.avivasysbio.com/snrnp48-antibody-c-terminal-region-arp95785-p050.html |
Name |
SNRNP48 Antibody - C-terminal region (ARP95785_P050) |
Protein Size (# AA) |
337 amino acids |
Molecular Weight |
37 kDa |
NCBI Gene Id |
67797 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
small nuclear ribonucleoprotein 48 (U11/U12) |
Alias Symbols |
C6orf151, 1110050F08Rik, 6530403A03Rik |
Peptide Sequence |
Synthetic peptide located within the following region: YLDVESSRHRRARSRSPHKRKRNKDKSSESRRRKERDGERHHSHKRRKQK |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
Likely involved in U12-type 5' splice site recognition. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-SNRNP48 (ARP95785_P050) antibody |
Blocking Peptide |
For anti-SNRNP48 (ARP95785_P050) antibody is Catalog # AAP95785 |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of mouse SNRNP48 |
Uniprot ID |
Q9D361 |
Protein Name |
U11/U12 small nuclear ribonucleoprotein 48 kDa protein |
Protein Accession # |
NP_080658.2 |
Purification |
Affinity purified |
Nucleotide Accession # |
NM_026382.2 |
Tested Species Reactivity |
Mouse |
Gene Symbol |
SNRNP48 |
Predicted Species Reactivity |
Mouse |
Application |
WB |
Image 1 | Mouse Liver
| Host: Rabbit Target Name: SNRNP48 Sample Tissue: Mouse Liver lysates Antibody Dilution: 1ug/ml |
|
|